dbPTM

PYP3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PYP3_SCHPO
UniProt AC	P32587
Protein Name	Tyrosine-protein phosphatase 3
Gene Name	pyp3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	303
Subcellular Localization	Cytoplasm.
Protein Description	Contributes to dephosphorylation of tyrosine 15 of cdc2..
Protein Sequence	MSFKEVSTENGVLTPLITIKEKAYMIIEGLNEEEIELLNTRLPKLSKKALARNRYSNIVPYENTRVRLDPMWKEACDYINASIVKIPSGKTFIATQGPTSNSIDVFWKMVWQSVPKSGIIVMLTKLRERHRLKCDIYWPVELFETLNIGDLSVILVKVYTLTSLNEVQVREFELNKDGVKKKILHFYYNGWPDFGAPHTFSLLSLTRYIKSLSYSPDFETAPIIVHCSAGCGRTGTFMALFEILSQTDDSTSTSKFEVDNIANIVSSLRSQRMQSVQSVDQLVFLYTVSQELLQGKEFLLPQL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PYP3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PYP3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PYP3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PYP3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPIP_SCHPO	cdc25	genetic	7961734
CDK1_SCHPO	cdc2	physical	1464318
SVF1_SCHPO	SPCC584.11c	genetic	22681890
G6PD2_SCHPO	zwf2	genetic	22681890
ASH2_SCHPO	ash2	genetic	22681890
YOSE_SCHPO	SPBC21C3.14c	genetic	22681890
YQMA_SCHPO	SPCP1E11.10	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PYP3_SCHPO

Related Literatures of Post-Translational Modification