UniProt ID | PYGO1_MOUSE | |
---|---|---|
UniProt AC | Q9D0P5 | |
Protein Name | Pygopus homolog 1 | |
Gene Name | Pygo1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 417 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in signal transduction through the Wnt pathway.. | |
Protein Sequence | MSAEQDKEPIALKRVRGGDSGLDGLGGPNIQLGSPDKKKRKANTQGSSFPPLSEYAPPPNPNSDHLVAANPFDDSYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSNFGNPPYNNVLTQDINMPGQHFRQGSAENFSQIPPQNVGQVSNPDLASNFAPGNNSNFTSPLETNHSFIPPPNAFGQAKAPLPKQDFTQGATKTPNQNSSTHPPHLNMEDPVNQSNVELKNVNRNNVVQENSRSGSAEATNNHANGTQNKPRQPRGAADLCTPDKSRKFSLLPSRHGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTREAFGPPAVGGDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Acetylation | -MSAEQDKEPIALKR -CCHHHCCCCCCCEE | 66.15 | 23236377 | |
13 | Acetylation | DKEPIALKRVRGGDS CCCCCCCEECCCCCC | 39.56 | 23236377 | |
34 | Phosphorylation | GPNIQLGSPDKKKRK CCCCCCCCCCHHHCC | 38.22 | 27180971 | |
290 | Phosphorylation | QENSRSGSAEATNNH CCCCCCCCCCCCCCC | 24.96 | 23684622 | |
294 | Phosphorylation | RSGSAEATNNHANGT CCCCCCCCCCCCCCC | 28.23 | - | |
301 | Phosphorylation | TNNHANGTQNKPRQP CCCCCCCCCCCCCCC | 28.86 | - | |
404 | Phosphorylation | KDVQLMRTREAFGPP CCHHHHHHHHHHCCC | 20.92 | 28059163 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PYGO1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PYGO1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PYGO1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CERS2_MOUSE | Cers2 | physical | 20211142 | |
ISL2_MOUSE | Isl2 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...