UniProt ID | PTTG_HUMAN | |
---|---|---|
UniProt AC | P53801 | |
Protein Name | Pituitary tumor-transforming gene 1 protein-interacting protein | |
Gene Name | PTTG1IP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . Cytoplasm . Nucleus . According to PubMed:10781616, it is found in the cytoplasm and the nucleus. |
|
Protein Description | May facilitate PTTG1 nuclear translocation.. | |
Protein Sequence | MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | N-linked_Glycosylation | AACSQNTNKTCEECL CCCCCCCCCCHHHHH | 45.23 | UniProtKB CARBOHYD | |
54 | N-linked_Glycosylation | TCEECLKNVSCLWCN CHHHHHHHCCEEEEC | 20.27 | 17660510 | |
132 | Phosphorylation | RSRKPDRSEEKAMRE CCCCCCHHHHHHHHH | 58.44 | 29514088 | |
135 | Ubiquitination | KPDRSEEKAMREREE CCCHHHHHHHHHHHH | 43.35 | - | |
156 | Phosphorylation | ERRAEMKTRHDEIRK HHHHHHHHHHHHHHH | 31.74 | - | |
164 | Ubiquitination | RHDEIRKKYGLFKEE HHHHHHHHHCCCCCC | 34.40 | 21890473 | |
165 | Phosphorylation | HDEIRKKYGLFKEEN HHHHHHHHCCCCCCC | 23.30 | 21082442 | |
169 | Ubiquitination | RKKYGLFKEENPYAR HHHHCCCCCCCCCCC | 69.98 | 21890473 | |
169 | Sumoylation | RKKYGLFKEENPYAR HHHHCCCCCCCCCCC | 69.98 | - | |
174 | Phosphorylation | LFKEENPYARFENN- CCCCCCCCCCCCCC- | 23.22 | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
174 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTTG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTTG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAB4A_HUMAN | RAB4A | physical | 21988832 | |
P53_HUMAN | TP53 | physical | 24506068 | |
CLC7A_HUMAN | CLEC7A | physical | 25416956 | |
LRAD1_HUMAN | LDLRAD1 | physical | 25416956 | |
P53_HUMAN | TP53 | physical | 25408419 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-174, AND MASSSPECTROMETRY. | |
"Multiple reaction monitoring for robust quantitative proteomicanalysis of cellular signaling networks."; Wolf-Yadlin A., Hautaniemi S., Lauffenburger D.A., White F.M.; Proc. Natl. Acad. Sci. U.S.A. 104:5860-5865(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-174, AND MASSSPECTROMETRY. | |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-165 AND TYR-174, ANDMASS SPECTROMETRY. |