PTPA_MYCTU - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PTPA_MYCTU
• UniProt AC: P9WIA1
• Protein Name: Probable low molecular weight protein-tyrosine-phosphatase
• Gene Name: ptpA
• Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv).
• Sequence Length: 163
• Subcellular Localization: Host endosome . Host cytoplasm . Translocates into the host cytosol by crossing the host phagosome membrane during human macrophage infection. Colocalizes with host VPS33B in macrophage cytosol and associates with phagosomes.
• Protein Description: Mediates host-pathogen interaction and interferes with vesicular trafficking in the infected macrophage. Inhibits host phagolysosomal fusion in M.tuberculosis-infected macrophages to promote bacteria survival. Dephosphorylates host VPS33B protein, which induces a block of the host phagosome maturation within macrophage cells. Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates..
• Protein Sequence: MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	VRVTSAGTGNWHVGS EEEEECCCCCCCCCC	27.36	25535696
53	S-nitrosylation	GNWHVGSCADERAAG CCCCCCCCCCHHHHH	4.56	20830431
128	Phosphorylation	ALDVEDPYYGDHSDF EECCCCCCCCCCCCH	32.19	19366344
129	Phosphorylation	LDVEDPYYGDHSDFE ECCCCCCCCCCCCHH	22.82	19366344

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
45	T	Phosphorylation	Kinase	PKNA	P9WI83	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PTPA_MYCTU !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PTPA_MYCTU !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC_HUMAN	UBC	physical	25642820
UBC_MOUSE	Ubc	physical	25642820
MK14_MOUSE	Mapk14	physical	25642820
MK08_MOUSE	Mapk8	physical	25642820
TAB3_MOUSE	Tab3	physical	25642820
TAB3_HUMAN	TAB3	physical	25642820
MK14_HUMAN	MAPK14	physical	25642820
MK08_HUMAN	MAPK8	physical	25642820

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.