dbPTM

PST2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PST2_ARATH
UniProt AC	Q39195
Protein Name	Photosystem II 5 kDa protein, chloroplastic
Gene Name	PSBT
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	103
Subcellular Localization	Plastid, chloroplast thylakoid membrane. Associated with the photosystem II complex..
Protein Description	May be a component of the oxygen-evolving complex..
Protein Sequence	MASMTMTATFFPAVAKVPSATGGRRLSVVRASTSDNTPSLEVKEQSSTTMRRDLMFTAAAAAVCSLAKVAMAEEEEPKRGTEAAKKKYAQVCVTMPTAKICRY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PST2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PST2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PST2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PST2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SUMO3_ARATH	SUMO3	physical	20855607
SUMO1_ARATH	SUMO1	physical	20855607

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PST2_ARATH

Related Literatures of Post-Translational Modification