UniProt ID | PRR5L_HUMAN | |
---|---|---|
UniProt AC | Q6MZQ0 | |
Protein Name | Proline-rich protein 5-like | |
Gene Name | PRR5L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 368 | |
Subcellular Localization | ||
Protein Description | Associates with the mTORC2 complex that regulates cellular processes including survival and organization of the cytoskeleton. [PubMed: 17461779 Regulates the activity of the mTORC2 complex in a substrate-specific manner preventing for instance the specific phosphorylation of PKCs and thereby controlling cell migration] | |
Protein Sequence | MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGENRIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQSKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGISGDRSFSGPTYTLARRHSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQLLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLEEGARGSQEGSELNCASLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | RPRPRFMSSPVLSDL CCCCCCCCCCCHHCC | 28.86 | 23401153 | |
29 | Phosphorylation | PRPRFMSSPVLSDLP CCCCCCCCCCHHCCH | 13.77 | 29255136 | |
33 | Phosphorylation | FMSSPVLSDLPRFQA CCCCCCHHCCHHHHH | 37.02 | 23403867 | |
71 | Phosphorylation | FKGGGLQSNELYALN HCCCCCCHHHHHHHH | 37.00 | 27499020 | |
86 | Ubiquitination | ENIRRLLKSELGSFI HHHHHHHHHHHHHHH | 46.61 | - | |
96 | Phosphorylation | LGSFITDYFQNQLLA HHHHHHHHHHHHHHH | 9.83 | - | |
112 | Ubiquitination | GLFFVEEKIKLCEGE CCCCHHHHHHHCCCC | 31.47 | - | |
181 | Phosphorylation | DLLLLAQSKLPSSIV HHHHHHCCCCCHHHH | 30.47 | - | |
182 | Acetylation | LLLLAQSKLPSSIVQ HHHHHCCCCCHHHHH | 52.95 | 12393115 | |
229 | Phosphorylation | LGISGDRSFSGPTYT HCCCCCCCCCCCCHH | 28.62 | 28060719 | |
231 | Phosphorylation | ISGDRSFSGPTYTLA CCCCCCCCCCCHHHH | 45.14 | 28060719 | |
234 | Phosphorylation | DRSFSGPTYTLARRH CCCCCCCCHHHHCCC | 32.44 | 28060719 | |
235 | Phosphorylation | RSFSGPTYTLARRHS CCCCCCCHHHHCCCC | 11.68 | 28060719 | |
236 | Phosphorylation | SFSGPTYTLARRHSR CCCCCCHHHHCCCCC | 19.20 | 28060719 | |
283 | Ubiquitination | EGEAYLEKCGSVRRH HHHHHHHHHCCCCCH | 41.10 | - | |
337 | Phosphorylation | PPPHRQCSSEPNITD CCCCCCCCCCCCCCC | 29.42 | 29116813 | |
356 | Phosphorylation | LEEGARGSQEGSELN CCCCCCCCCCCCCCC | 21.36 | 27690223 | |
360 | Phosphorylation | ARGSQEGSELNCASL CCCCCCCCCCCCCCC | 37.85 | 27690223 | |
366 | Phosphorylation | GSELNCASLS----- CCCCCCCCCC----- | 31.20 | 23312004 | |
368 | Phosphorylation | ELNCASLS------- CCCCCCCC------- | 35.36 | 22617229 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRR5L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRR5L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTOR_HUMAN | MTOR | physical | 18030348 | |
RICTR_HUMAN | RICTOR | physical | 18030348 | |
SIN1_HUMAN | MAPKAP1 | physical | 18030348 | |
TTP_HUMAN | ZFP36 | physical | 21964062 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...