| UniProt ID | PRA1E_ARATH | |
|---|---|---|
| UniProt AC | Q9FRR1 | |
| Protein Name | PRA1 family protein E | |
| Gene Name | PRA1E | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 209 | |
| Subcellular Localization |
Endosome membrane Multi-pass membrane protein . |
|
| Protein Description | May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.. | |
| Protein Sequence | MNQKPPPYGYGGAGGGGVGPSSTSNTTIIGTLSARAKQTTQSMITTLRPWREILDLSALSLPRGYDEAMAHLKHNISYFRGNYALAVLAIVFLGLIYHPMSMIAFIVVFIGWILLYFSRDANDSIVISGKEVDDKIVLVLLSLVTVLALVYTDVGENVLVSLIIGLLIVGAHGAFRNTDDLFLDEESARRGGLVSAGSGNRPPSSYTPI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MNQKPPPYGYGGAGG CCCCCCCCCCCCCCC | 28.84 | 23776212 | |
| 10 | Phosphorylation | QKPPPYGYGGAGGGG CCCCCCCCCCCCCCC | 13.42 | 23776212 | |
| 21 | Phosphorylation | GGGGVGPSSTSNTTI CCCCCCCCCCCCCEE | 40.08 | 23776212 | |
| 22 | Phosphorylation | GGGVGPSSTSNTTII CCCCCCCCCCCCEEE | 38.70 | 23776212 | |
| 23 | Phosphorylation | GGVGPSSTSNTTIIG CCCCCCCCCCCEEEE | 30.27 | 23776212 | |
| 24 | Phosphorylation | GVGPSSTSNTTIIGT CCCCCCCCCCEEEEE | 33.84 | 23776212 | |
| 26 | Phosphorylation | GPSSTSNTTIIGTLS CCCCCCCCEEEEEHH | 21.09 | 23776212 | |
| 27 | Phosphorylation | PSSTSNTTIIGTLSA CCCCCCCEEEEEHHH | 18.17 | 23776212 | |
| 31 | Phosphorylation | SNTTIIGTLSARAKQ CCCEEEEEHHHHHHH | 13.71 | 23776212 | |
| 33 | Phosphorylation | TTIIGTLSARAKQTT CEEEEEHHHHHHHHH | 18.62 | 23776212 | |
| 178 | Phosphorylation | AHGAFRNTDDLFLDE CCHHCCCCCCCCCCH | 27.00 | 23776212 | |
| 187 | Phosphorylation | DLFLDEESARRGGLV CCCCCHHHHHCCCCC | 25.65 | 23776212 | |
| 195 | Phosphorylation | ARRGGLVSAGSGNRP HHCCCCCCCCCCCCC | 31.77 | 23776212 | |
| 198 | Phosphorylation | GGLVSAGSGNRPPSS CCCCCCCCCCCCCCC | 32.39 | 23776212 | |
| 204 | Phosphorylation | GSGNRPPSSYTPI-- CCCCCCCCCCCCC-- | 38.36 | 23776212 | |
| 205 | Phosphorylation | SGNRPPSSYTPI--- CCCCCCCCCCCC--- | 38.51 | 23776212 | |
| 206 | Phosphorylation | GNRPPSSYTPI---- CCCCCCCCCCC---- | 22.37 | 23776212 | |
| 207 | Phosphorylation | NRPPSSYTPI----- CCCCCCCCCC----- | 19.22 | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRA1E_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRA1E_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRA1E_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ERL2_ARATH | ERL2 | physical | 24833385 | |
| UBC32_ARATH | UBC32 | physical | 24833385 | |
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| GSTUJ_ARATH | GSTU19 | physical | 24833385 | |
| MBF1C_ARATH | MBF1C | physical | 24833385 | |
| CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
| RAC8_ARATH | ROP10 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...