| UniProt ID | PPR1B_HUMAN | |
|---|---|---|
| UniProt AC | Q9UD71 | |
| Protein Name | Protein phosphatase 1 regulatory subunit 1B | |
| Gene Name | PPP1R1B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 204 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Inhibitor of protein-phosphatase 1.. | |
| Protein Sequence | MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDPKDRKK -------CCHHHHHC | 21.02 | - | |
| 9 (in isoform 2) | Phosphorylation | - | 5.84 | 2557337 | |
| 12 | Phosphorylation | DRKKIQFSVPAPPSQ HHHCCCEECCCCHHH | 15.71 | 27251275 | |
| 18 | Phosphorylation | FSVPAPPSQLDPRQV EECCCCHHHCCHHHH | 42.17 | 30243723 | |
| 34 | Phosphorylation | MIRRRRPTPAMLFRL HHHHHCCCHHHHHHH | 23.13 | 19651774 | |
| 42 | Phosphorylation | PAMLFRLSEHSSPEE HHHHHHHHCCCCHHH | 29.07 | 23312004 | |
| 45 | Phosphorylation | LFRLSEHSSPEEEAS HHHHHCCCCHHHHCC | 43.46 | 26657352 | |
| 46 | Phosphorylation | FRLSEHSSPEEEASP HHHHCCCCHHHHCCH | 37.93 | 28188228 | |
| 52 | Phosphorylation | SSPEEEASPHQRASG CCHHHHCCHHHHCCC | 26.62 | 23312004 | |
| 58 | Phosphorylation | ASPHQRASGEGHHLK CCHHHHCCCCCCCCC | 39.30 | 24719451 | |
| 66 | Phosphorylation | GEGHHLKSKRPNPCA CCCCCCCCCCCCCCC | 40.01 | 2557337 | |
| 74 | Phosphorylation | KRPNPCAYTPPSLKA CCCCCCCCCCHHHHH | 26.88 | 23312004 | |
| 75 | Phosphorylation | RPNPCAYTPPSLKAV CCCCCCCCCHHHHHH | 15.36 | 22617229 | |
| 78 | Phosphorylation | PCAYTPPSLKAVQRI CCCCCCHHHHHHHHH | 43.64 | 22617229 | |
| 92 | Phosphorylation | IAESHLQSISNLNEN HHHHHHHHHHHCCCC | 34.05 | 29802988 | |
| 94 | Phosphorylation | ESHLQSISNLNENQA HHHHHHHHHCCCCCC | 40.28 | 26503514 | |
| 102 | Phosphorylation | NLNENQASEEEDELG HCCCCCCCHHHHHHH | 35.46 | 28355574 | |
| 116 | Phosphorylation | GELRELGYPREEDEE HHHHHHCCCCCCCCC | 16.25 | - | |
| 137 | Phosphorylation | EEEEEEDSQAEVLKV HHHHHHHHHHHHHHH | 34.27 | 26657352 | |
| 148 | Phosphorylation | VLKVIRQSAGQKTTC HHHHHHHHCCCCCCC | 25.23 | 24719451 | |
| 153 | Phosphorylation | RQSAGQKTTCGQGLE HHHCCCCCCCCCCCC | 21.30 | 23312004 | |
| 154 | Phosphorylation | QSAGQKTTCGQGLEG HHCCCCCCCCCCCCC | 22.98 | 23312004 | |
| 172 | Phosphorylation | RPPPLDESERDGGSE CCCCCCHHHCCCCCC | 37.28 | 23312004 | |
| 178 | Phosphorylation | ESERDGGSEDQVEDP HHHCCCCCCCCCCCC | 43.46 | 28348404 | |
| 188 | Phosphorylation | QVEDPALSEPGEEPQ CCCCCCCCCCCCCCC | 43.80 | 28188228 | |
| 198 | Phosphorylation | GEEPQRPSPSEPGT- CCCCCCCCCCCCCC- | 43.16 | 26657352 | |
| 200 | Phosphorylation | EPQRPSPSEPGT--- CCCCCCCCCCCC--- | 61.84 | 28348404 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 34 | T | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
| 34 | T | Phosphorylation | Kinase | PKA | - | Uniprot |
| 75 | T | Phosphorylation | Kinase | CDK5 | Q00535 | Uniprot |
| 75 | T | Phosphorylation | Kinase | CDK-FAMILY | - | GPS |
| 75 | T | Phosphorylation | Kinase | CDK_GROUP | - | PhosphoELM |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 34 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPR1B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DLGP4_HUMAN | DLGAP4 | physical | 16169070 | |
| KLHL6_HUMAN | KLHL6 | physical | 25416956 | |
| ACTBL_HUMAN | ACTBL2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphorylation of DARPP-32 by Cdk5 modulates dopamine signalling inneurons."; Bibb J.A., Snyder G.L., Nishi A., Yan Z., Meijer L., Fienberg A.A.,Tsai L.-H., Kwon Y.T., Girault J.-A., Czernik A.J., Huganir R.L.,Hemmings H.C. Jr., Nairn A.C., Greengard P.; Nature 402:669-671(1999). Cited for: PHOSPHORYLATION AT THR-75 BY CDK5. | |