dbPTM

PPCT_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PPCT_HUMAN
UniProt AC	Q9UKL6
Protein Name	Phosphatidylcholine transfer protein
Gene Name	PCTP
Organism	Homo sapiens (Human).
Sequence Length	214
Subcellular Localization	Cytoplasm .
Protein Description	Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule..
Protein Sequence	MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MELAAGSF -------CCCCCCCC	9.57	-
100	Phosphorylation	CNGETVVYWEVKYPF CCCEEEEEEEEEECC	7.48	23663014
105	Phosphorylation	VVYWEVKYPFPMSNR EEEEEEEECCCCCCC	18.45	23663014
110	Phosphorylation	VKYPFPMSNRDYVYL EEECCCCCCCCEEEE	29.02	23663014
137	Phosphorylation	IHVILARSTSMPQLG EEEEEEECCCCCCCC	21.16	28450419
138	Phosphorylation	HVILARSTSMPQLGE EEEEEECCCCCCCCC	24.40	28450419
139	Phosphorylation	VILARSTSMPQLGER EEEEECCCCCCCCCC	29.70	23927012
140	Sulfoxidation	ILARSTSMPQLGERS EEEECCCCCCCCCCC	2.19	21406390

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PPCT_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PPCT_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PPCT_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACO13_HUMAN	ACOT13	physical	17704541
PAX3_HUMAN	PAX3	physical	17704541
VAPA_HUMAN	VAPA	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PPCT_HUMAN

Related Literatures of Post-Translational Modification