PPAL_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PPAL_SCHPO
• UniProt AC: P41893
• Protein Name: Low molecular weight phosphotyrosine protein phosphatase
• Gene Name: stp1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 156
• Subcellular Localization: Cytoplasm.
• Protein Description: May contribute to dephosphorylation of 'Tyr-15' of cdc2..
• Protein Sequence: MTKNIQVLFVCLGNICRSPMAEAVFRNEVEKAGLEARFDTIDSCGTGAWHVGNRPDPRTLEVLKKNGIHTKHLARKLSTSDFKNFDYIFAMDSSNLRNINRVKPQGSRAKVMLFGEYASPGVSKIVDDPYYGGSDGFGDCYIQLVDFSQNFLKSIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	KHLARKLSTSDFKNF HHHHHHCCCCHHCCC	28.97	25720772
79	Phosphorylation	HLARKLSTSDFKNFD HHHHHCCCCHHCCCC	42.63	29996109
80	Phosphorylation	LARKLSTSDFKNFDY HHHHCCCCHHCCCCE	37.36	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PPAL_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PPAL_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PPAL_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HPC2_SCHPO	hip4	genetic	18818364
PDS5_SCHPO	pds5	genetic	18818364
HOP2_SCHPO	meu13	genetic	18818364
ZDS1_SCHPO	zds1	genetic	18818364
EME1_SCHPO	eme1	genetic	18818364
CSN1_SCHPO	csn1	genetic	18818364
YB3C_SCHPO	cay1	genetic	18818364
ELP1_SCHPO	elp1	genetic	18818364
SNF59_SCHPO	snf59	genetic	22681890
CBH1_SCHPO	cbh1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.