UniProt ID | POZP3_HUMAN | |
---|---|---|
UniProt AC | Q6PJE2 | |
Protein Name | POM121 and ZP3 fusion protein | |
Gene Name | POMZP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 187 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MVCSPVTLRIA ----CCCCCEEEEEC | 15.82 | 30001349 | |
7 | Phosphorylation | -MVCSPVTLRIAPPD -CCCCCEEEEECCCC | 17.44 | 30001349 | |
18 | Phosphorylation | APPDRRFSRSAIPEQ CCCCCCCCCCCCCHH | 24.42 | 26074081 | |
20 | Phosphorylation | PDRRFSRSAIPEQII CCCCCCCCCCCHHHH | 29.38 | 30108239 | |
28 | Phosphorylation | AIPEQIISSTLSSPS CCCHHHHHHCCCCCC | 20.92 | 30576142 | |
29 | Phosphorylation | IPEQIISSTLSSPSS CCHHHHHHCCCCCCC | 23.98 | 30108239 | |
30 | Phosphorylation | PEQIISSTLSSPSSN CHHHHHHCCCCCCCC | 24.70 | 25159151 | |
32 | Phosphorylation | QIISSTLSSPSSNAP HHHHHCCCCCCCCCC | 40.05 | 25159151 | |
33 | Phosphorylation | IISSTLSSPSSNAPD HHHHCCCCCCCCCCC | 31.73 | 30278072 | |
35 | Phosphorylation | SSTLSSPSSNAPDPC HHCCCCCCCCCCCHH | 37.87 | 30278072 | |
36 | Phosphorylation | STLSSPSSNAPDPCA HCCCCCCCCCCCHHH | 40.16 | 30108239 | |
44 | Ubiquitination | NAPDPCAKETVLSAL CCCCHHHHHHHHHHH | 61.71 | - | |
46 | Phosphorylation | PDPCAKETVLSALKE CCHHHHHHHHHHHHH | 26.49 | 23403867 | |
49 | Phosphorylation | CAKETVLSALKEKKK HHHHHHHHHHHHHHH | 27.50 | 30266825 | |
59 | Phosphorylation | KEKKKKRTVEEEDQI HHHHHCCCCCHHHCC | 40.94 | 24961811 | |
74 | Ubiquitination | FLDGQENKRSCLVDG EECCCCCCCEEEECC | 44.96 | 2190698 | |
136 | Ubiquitination | QDPDELNKACSFSKP CCHHHHHHHHCCCCC | 64.49 | 29967540 | |
139 | Phosphorylation | DELNKACSFSKPSNS HHHHHHHCCCCCCCC | 37.10 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POZP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POZP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POZP3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...