| UniProt ID | PNRC2_HUMAN | |
|---|---|---|
| UniProt AC | Q9NPJ4 | |
| Protein Name | Proline-rich nuclear receptor coactivator 2 | |
| Gene Name | PNRC2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 139 | |
| Subcellular Localization | Nucleus . Cytoplasm, P-body . | |
| Protein Description | Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. [PubMed: 19150429 May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs] | |
| Protein Sequence | MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 (in isoform 2) | Phosphorylation | - | 29.45 | 22210691 | |
| 19 | Ubiquitination | PQSRNVSKNQQQLNR CCCCCCCHHHHHHHH | 55.27 | 29967540 | |
| 34 | Phosphorylation | QKTKEQNSQMKIVHK HHHHHHHHHCEEEEC | 31.20 | 29978859 | |
| 37 | Ubiquitination | KEQNSQMKIVHKKKE HHHHHHCEEEECHHH | 33.66 | - | |
| 67 (in isoform 2) | Ubiquitination | - | 67.98 | 21906983 | |
| 76 | Phosphorylation | PNNQSWNSSLSGPRL CCCCCCCCCCCCCEE | 26.80 | 24732914 | |
| 77 | Phosphorylation | NNQSWNSSLSGPRLL CCCCCCCCCCCCEEE | 24.28 | 24732914 | |
| 79 | Phosphorylation | QSWNSSLSGPRLLFK CCCCCCCCCCEEEEE | 49.01 | 24732914 | |
| 86 | Ubiquitination | SGPRLLFKSQANQNY CCCEEEEECCCCCCC | 41.44 | 22817900 | |
| 86 (in isoform 1) | Ubiquitination | - | 41.44 | 21906983 | |
| 93 | Phosphorylation | KSQANQNYAGAKFSE ECCCCCCCCCCCCCC | 9.17 | - | |
| 103 | Phosphorylation | AKFSEPPSPSVLPKP CCCCCCCCCCCCCCC | 40.29 | 25627689 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNRC2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNRC2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNRC2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DCP1A_HUMAN | DCP1A | physical | 15604093 | |
| TZAP_HUMAN | ZBTB48 | physical | 21900206 | |
| JIP4_HUMAN | SPAG9 | physical | 21900206 | |
| XRCC6_HUMAN | XRCC6 | physical | 21900206 | |
| GLOD4_HUMAN | GLOD4 | physical | 21900206 | |
| ERR3_HUMAN | ESRRG | physical | 14651967 | |
| DCP1A_HUMAN | DCP1A | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
