UniProt ID | PLAC9_HUMAN | |
---|---|---|
UniProt AC | Q5JTB6 | |
Protein Name | Placenta-specific protein 9 | |
Gene Name | PLAC9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 97 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | ALLRAAGSLAAAEPF HHHHHHHHHHHCCCC | 15.31 | 23186163 | |
27 | Phosphorylation | LAAAEPFSPPRGDSA HHHCCCCCCCCCCCH | 44.72 | 26091039 | |
87 | O-linked_Glycosylation | NLPPGPFSPAPDLLG CCCCCCCCCCCCCCC | 24.24 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLAC9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLAC9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLAC9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPGF5_HUMAN | RAPGEF5 | physical | 21988832 | |
RN213_HUMAN | RNF213 | physical | 21988832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...