UniProt ID | PIGP_HUMAN | |
---|---|---|
UniProt AC | P57054 | |
Protein Name | Phosphatidylinositol N-acetylglucosaminyltransferase subunit P | |
Gene Name | PIGP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 158 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.. | |
Protein Sequence | MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVPRSTSLTLIVF --CCCCHHHHHHHHH | 29.09 | - | |
6 | Phosphorylation | --MVPRSTSLTLIVF --CCCCHHHHHHHHH | 29.09 | - | |
9 | Phosphorylation | VPRSTSLTLIVFLFH CCCHHHHHHHHHHHH | 17.76 | - | |
9 | Phosphorylation | VPRSTSLTLIVFLFH CCCHHHHHHHHHHHH | 17.76 | - | |
19 | Phosphorylation | VFLFHRLSKAPGKMV HHHHHHHHCCCCCCC | 27.08 | - | |
19 | Phosphorylation | VFLFHRLSKAPGKMV HHHHHHHHCCCCCCC | 27.08 | - | |
29 | Phosphorylation | PGKMVENSPSPLPER CCCCCCCCCCCCCHH | 17.16 | 27732954 | |
31 | Phosphorylation | KMVENSPSPLPERAI CCCCCCCCCCCHHHH | 38.60 | 27732954 | |
102 | Ubiquitination | VLLFGINMMSTSPLD HHHHCHHHHCCCCCC | 1.80 | 29967540 | |
126 | Ubiquitination | AKNQQQKKYQEEAIP HHHHHHHHHHHHHHH | 48.07 | 29967540 | |
157 | Ubiquitination | AAKELYTKN------ HHHHHHCCC------ | 47.29 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIGP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIGP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIGP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PIGA_HUMAN | PIGA | physical | 10944123 | |
PIGQ_HUMAN | PIGQ | physical | 10944123 | |
ASC_HUMAN | PYCARD | physical | 28514442 | |
PIGA_HUMAN | PIGA | physical | 28514442 | |
PIGH_HUMAN | PIGH | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...