PHS_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PHS_SCHPO
• UniProt AC: O42658
• Protein Name: Pterin-4-alpha-carbinolamine dehydratase
• Gene Name: omt2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 96
• Subcellular Localization: Spore wall . Inner spore wall.
• Protein Description: Has a role in spore wall formation..
• Protein Sequence: MNTSARLLALVSKSKNNWILQQGDTKLFKSFRFKNFIEAWGFMSCVALRAQQLNHHPEWTNVYNKVDITLTTHDTKGLTEKDLKLAEFIDTLAKDN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MNTSARLLAL -----CCHHHHHHHH	23.59	21712547
4	Phosphorylation	----MNTSARLLALV ----CCHHHHHHHHH	13.34	21712547
14	Phosphorylation	LLALVSKSKNNWILQ HHHHHHHCCCCEEEC	32.86	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PHS_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PHS_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PHS_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IMA1_SCHPO	cut15	physical	23695164
RCD1_SCHPO	rcd1	physical	23695164
PHS_SCHPO	omt2	physical	23695164
PHS_SCHPO	omt2	physical	26771498
RCD1_SCHPO	rcd1	physical	26771498
YF75_SCHPO	spa2	physical	26771498
IMA2_SCHPO	imp1	physical	26771498
IMA1_SCHPO	cut15	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.