dbPTM

PHOCN_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PHOCN_RAT
UniProt AC	Q9QYW3
Protein Name	MOB-like protein phocein
Gene Name	Mob4
Organism	Rattus norvegicus (Rat).
Sequence Length	225
Subcellular Localization	Cytoplasm. Membrane Peripheral membrane protein. Golgi apparatus, Golgi stack membrane Peripheral membrane protein. Detected in cell bodies and dendrites of neurons, but not in axons.
Protein Description	May play a role in membrane trafficking, specifically in membrane budding reactions..
Protein Sequence	MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MVMAEGTAVLRRNR -CCCCCCCEEEECCC	12.71	25575281
140	Acetylation	ACLLNSNKYFPSRVS HHHHCCCCCCCCCEE	48.35	22902405
141	Phosphorylation	CLLNSNKYFPSRVSI HHHCCCCCCCCCEEE	25.60	-
144	Phosphorylation	NSNKYFPSRVSIKES CCCCCCCCCEEECHH	35.10	23984901
147	Phosphorylation	KYFPSRVSIKESSVA CCCCCCEEECHHHHH	27.17	23984901
155	Acetylation	IKESSVAKLGSVCRR ECHHHHHHHHHHHHH	51.75	25786129

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PHOCN_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PHOCN_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PHOCN_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
NDKB_RAT	Nme2	physical	11872741
FRIH_RAT	Fth1	physical	11872741

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PHOCN_RAT

Related Literatures of Post-Translational Modification