UniProt ID | PGTB1_SCHPO | |
---|---|---|
UniProt AC | P32434 | |
Protein Name | Geranylgeranyl transferase type-1 subunit beta | |
Gene Name | cwg2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 355 | |
Subcellular Localization | ||
Protein Description | Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal C-A-A-L where A is an aliphatic amino acid. In particular it modifies the GTP-binding component of the 1,3-beta-D-glucan synthase.. | |
Protein Sequence | MELTRAKHIAFFKRHLILFPTPYEEHDCERTVLAFFCLLGLDLLNALNTIDDDDKKSWIEWIYKNYVTKESKGIKYSGFQAYRTGIQPISFEQEPQLAGTVFSICCLLFLGDNLSRIDRDLIKNFVELCKTSQGHFRSIAVPSCSDQDMRQLYMATTIASLLDFSLSDPLCSIQYIKSCQRYEGGFSLLPYGEAHAGATFCALASWSLILKMIPNSSLNTSNQSYNLMDCVPKVERLIRWLASRQLSSGGLNGRTNKDVDTCYAYWVLSSLKLLDALPFIDGGELEKYLLLHAQHALGGFSKTPGEFPDVLHSALGLYAMAYQDDKSFPKVNADIHMTSKYINICRDCIQAAKGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PGTB1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGTB1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGTB1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGTB1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RHO1_SCHPO | rho1 | genetic | 8887550 | |
FNTA_SCHPO | cwp1 | physical | 9781874 | |
FNTA_SCHPO | cwp1 | physical | 26771498 | |
SPM1_SCHPO | pmk1 | genetic | 25651781 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...