PGTB1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PGTB1_SCHPO
• UniProt AC: P32434
• Protein Name: Geranylgeranyl transferase type-1 subunit beta
• Gene Name: cwg2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 355
• Protein Description: Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal C-A-A-L where A is an aliphatic amino acid. In particular it modifies the GTP-binding component of the 1,3-beta-D-glucan synthase..
• Protein Sequence: MELTRAKHIAFFKRHLILFPTPYEEHDCERTVLAFFCLLGLDLLNALNTIDDDDKKSWIEWIYKNYVTKESKGIKYSGFQAYRTGIQPISFEQEPQLAGTVFSICCLLFLGDNLSRIDRDLIKNFVELCKTSQGHFRSIAVPSCSDQDMRQLYMATTIASLLDFSLSDPLCSIQYIKSCQRYEGGFSLLPYGEAHAGATFCALASWSLILKMIPNSSLNTSNQSYNLMDCVPKVERLIRWLASRQLSSGGLNGRTNKDVDTCYAYWVLSSLKLLDALPFIDGGELEKYLLLHAQHALGGFSKTPGEFPDVLHSALGLYAMAYQDDKSFPKVNADIHMTSKYINICRDCIQAAKGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PGTB1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PGTB1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PGTB1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PGTB1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RHO1_SCHPO	rho1	genetic	8887550
FNTA_SCHPO	cwp1	physical	9781874
FNTA_SCHPO	cwp1	physical	26771498
SPM1_SCHPO	pmk1	genetic	25651781

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.