| UniProt ID | PDZ1I_HUMAN | |
|---|---|---|
| UniProt AC | Q13113 | |
| Protein Name | PDZK1-interacting protein 1 | |
| Gene Name | PDZK1IP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 114 | |
| Subcellular Localization |
Membrane Single-pass membrane protein. |
|
| Protein Description | May play an important role in tumor biology.. | |
| Protein Sequence | MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 83 | Phosphorylation | LVGTDGRYSSMAASF EEECCCCCHHHHHHH | 15.61 | 28442448 | |
| 84 | Phosphorylation | VGTDGRYSSMAASFR EECCCCCHHHHHHHC | 16.57 | 28442448 | |
| 85 | Phosphorylation | GTDGRYSSMAASFRS ECCCCCHHHHHHHCC | 11.96 | 28857561 | |
| 89 | Phosphorylation | RYSSMAASFRSSEHE CCHHHHHHHCCCCCC | 16.20 | 28857561 | |
| 92 | Phosphorylation | SMAASFRSSEHENAY HHHHHHCCCCCCCCH | 37.76 | 26356563 | |
| 93 | Phosphorylation | MAASFRSSEHENAYE HHHHHCCCCCCCCHH | 38.42 | 26356563 | |
| 99 | Phosphorylation | SSEHENAYENVPEEE CCCCCCCHHCCCHHH | 21.44 | 27259358 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDZ1I_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDZ1I_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDZ1I_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NHRF3_HUMAN | PDZK1 | physical | 14531806 | |
| NHRF3_HUMAN | PDZK1 | physical | 12837682 | |
| CSN6_HUMAN | COPS6 | physical | 16169070 | |
| UT14A_HUMAN | UTP14A | physical | 16169070 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
