PCNA_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PCNA_CAEEL
• UniProt AC: O02115
• Protein Name: Proliferating cell nuclear antigen
• Gene Name: pcn-1
• Organism: Caenorhabditis elegans.
• Sequence Length: 263
• Subcellular Localization: Nucleus.
• Protein Description: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand..
• Protein Sequence: MFEAKLANAGLLKKIVESIKDLVTDAPFDCSETAMSLQAMDSSHVALVSLKLEVGLFDTYRCDRTINLGLSLANMSKALKCANNDDTCMLKYEENEGDSIIFTFADPKRDKTQDVTVKMMDIDSEHLGIPDQDYAVVCEMPAGEFQKTCKDLSTFSDSLNITATKAGIVFTGKGDIGSSVVTYSPSSNTDDETEAVTLEVKDPVNVNFSIKYMNQFTKATALSDRVRLSLCNDVPVVVEYPIEENGYLRFYLAPKIDDDENMD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PCNA_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PCNA_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PCNA_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PCNA_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PHO11_CAEEL	pho-11	physical	14704431
GLYC_CAEEL	mel-32	physical	14704431
PCNA_CAEEL	pcn-1	physical	14704431
PCNA_CAEEL	pcn-1	physical	18692475

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.