PCNA2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PCNA2_ARATH
• UniProt AC: Q9ZW35
• Protein Name: Proliferating cell nuclear antigen 2
• Gene Name: PCNA2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 264
• Subcellular Localization: Nucleus.
• Protein Description: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (By similarity). May be involved in UV resistance..
• Protein Sequence: MLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSGEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEEEDTKPE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PCNA2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PCNA2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PCNA2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PCNA2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SM3L2_ARATH	RAD5	physical	23314815
UBQ3_ARATH	UBQ3	physical	23314815
PCNA2_ARATH	PCNA2	physical	19388052
CDN1A_HUMAN	CDKN1A	physical	19388052

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.