PAX4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PAX4_HUMAN
• UniProt AC: O43316
• Protein Name: Paired box protein Pax-4
• Gene Name: PAX4
• Organism: Homo sapiens (Human).
• Sequence Length: 350
• Subcellular Localization: Nucleus.
• Protein Description: Plays an important role in the differentiation and development of pancreatic islet beta cells. Transcriptional repressor that binds to a common element in the glucagon, insulin and somatostatin promoters. Competes with PAX6 for this same promoter binding site. Isoform 2 appears to be a dominant negative form antagonizing PAX4 transcriptional activity..
• Protein Sequence: MHQDGISSMNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACLKPCWDCGSFLLPVIAPSCVDVAWPCLDASLAHHLIGGAGKATPTHFSHWP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MHQDGISSMNQLGG -CCCCCCCCCHHCCC	29.12	24043423
8	Phosphorylation	MHQDGISSMNQLGGL CCCCCCCCCHHCCCE	21.60	24043423
26	Phosphorylation	GRPLPLDTRQQIVRL CEECCCCHHHHHHHH	37.75	24043423
56	Phosphorylation	VSNGCVSKILGRYYR CCCCHHHHHHHHHHH	22.89	27251275
64	Phosphorylation	ILGRYYRTGVLEPKG HHHHHHHCCCCCCCC	18.60	27251275
144	Phosphorylation	LPCTRLRSPAVLAPA CCCCCCCCHHEEECE	23.08	24114839
157	Phosphorylation	PAVLTPHSGSETPRG CEEECCCCCCCCCCC	45.26	24114839
159	Phosphorylation	VLTPHSGSETPRGTH EECCCCCCCCCCCCC	41.11	24114839
161	Phosphorylation	TPHSGSETPRGTHPG CCCCCCCCCCCCCCC	21.71	24114839
245	Phosphorylation	PGASQGLTVPRVAPG CCCCCCCCCCCCCCC	34.98	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PAX4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PAX4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PAX4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GMCL1_HUMAN	GMCL1	physical	25416956
FLNC_HUMAN	FLNC	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.