UniProt ID | PAX4_HUMAN | |
---|---|---|
UniProt AC | O43316 | |
Protein Name | Paired box protein Pax-4 | |
Gene Name | PAX4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 350 | |
Subcellular Localization | Nucleus. | |
Protein Description | Plays an important role in the differentiation and development of pancreatic islet beta cells. Transcriptional repressor that binds to a common element in the glucagon, insulin and somatostatin promoters. Competes with PAX6 for this same promoter binding site. Isoform 2 appears to be a dominant negative form antagonizing PAX4 transcriptional activity.. | |
Protein Sequence | MHQDGISSMNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACLKPCWDCGSFLLPVIAPSCVDVAWPCLDASLAHHLIGGAGKATPTHFSHWP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MHQDGISSMNQLGG -CCCCCCCCCHHCCC | 29.12 | 24043423 | |
8 | Phosphorylation | MHQDGISSMNQLGGL CCCCCCCCCHHCCCE | 21.60 | 24043423 | |
26 | Phosphorylation | GRPLPLDTRQQIVRL CEECCCCHHHHHHHH | 37.75 | 24043423 | |
56 | Phosphorylation | VSNGCVSKILGRYYR CCCCHHHHHHHHHHH | 22.89 | 27251275 | |
64 | Phosphorylation | ILGRYYRTGVLEPKG HHHHHHHCCCCCCCC | 18.60 | 27251275 | |
144 | Phosphorylation | LPCTRLRSPAVLAPA CCCCCCCCHHEEECE | 23.08 | 24114839 | |
157 | Phosphorylation | PAVLTPHSGSETPRG CEEECCCCCCCCCCC | 45.26 | 24114839 | |
159 | Phosphorylation | VLTPHSGSETPRGTH EECCCCCCCCCCCCC | 41.11 | 24114839 | |
161 | Phosphorylation | TPHSGSETPRGTHPG CCCCCCCCCCCCCCC | 21.71 | 24114839 | |
245 | Phosphorylation | PGASQGLTVPRVAPG CCCCCCCCCCCCCCC | 34.98 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAX4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAX4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAX4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GMCL1_HUMAN | GMCL1 | physical | 25416956 | |
FLNC_HUMAN | FLNC | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...