PAWR_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PAWR_RAT
• UniProt AC: Q62627
• Protein Name: PRKC apoptosis WT1 regulator protein
• Gene Name: Pawr
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 332
• Subcellular Localization: Cytoplasm. Nucleus. Mainly cytoplasmic in absence of apoptosis signal and in normal cells. Nuclear in most cancer cell lines. Nuclear entry seems to be essential but not sufficient for apoptosis. Nuclear localization includes nucleoplasm and PML nucl
• Protein Description: Pro-apoptopic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1 (By similarity)..
• Protein Sequence: MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGRYKSTISAPEEEILNRYPRTDRSGFSRHNRDTSAPANFASSSTLEKRIEDLEKEVLRERQENLRLTRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MATGGYRSSGSTTDF CCCCCCCCCCCHHHH	30.48	23984901
9	Phosphorylation	ATGGYRSSGSTTDFL CCCCCCCCCCHHHHH	27.97	23984901
11	Phosphorylation	GGYRSSGSTTDFLEE CCCCCCCCHHHHHHH	30.04	27097102
12	Phosphorylation	GYRSSGSTTDFLEEW CCCCCCCHHHHHHHH	33.63	23984901
13	Phosphorylation	YRSSGSTTDFLEEWK CCCCCCHHHHHHHHH	26.84	23984901
37	Phosphorylation	QNPVGPGSSGGDPAA CCCCCCCCCCCCCCC	29.01	28432305
38	Phosphorylation	NPVGPGSSGGDPAAK CCCCCCCCCCCCCCC	53.35	28432305
115	Phosphorylation	GAAGAPASRGDEEEP CCCCCCCCCCCCCCC	35.42	23984901
124	Phosphorylation	GDEEEPDSAPEKGRS CCCCCCCCCCCCCCC	57.34	29779826
155	Phosphorylation	LREKRRSTGVVNIPA HHHHHHHCCCCCCCH	31.98	16209943
223	Phosphorylation	GRYKSTISAPEEEIL CCCCCCCCCCHHHHH	37.55	-
248	Phosphorylation	FSRHNRDTSAPANFA CCCCCCCCCCCCCCC	24.45	23984901
249	Phosphorylation	SRHNRDTSAPANFAS CCCCCCCCCCCCCCC	36.22	16209943
256	Phosphorylation	SAPANFASSSTLEKR CCCCCCCCCHHHHHH	22.23	28432305
257	Phosphorylation	APANFASSSTLEKRI CCCCCCCCHHHHHHH	24.74	28432305
258	Phosphorylation	PANFASSSTLEKRIE CCCCCCCHHHHHHHH	34.22	28432305
259	Phosphorylation	ANFASSSTLEKRIED CCCCCCHHHHHHHHH	40.67	28432305
288	Acetylation	LTRLMQDKEEMIGKL HHHHHCCHHHHHHHH	38.39	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
124	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
124	S	Phosphorylation	Kinase	CK2A1	P19139	PSP
154	S	Phosphorylation	Kinase	DAPK3	O88764	GPS
155	T	Phosphorylation	Kinase	DAPK3	O88764	GPS
155	T	Phosphorylation	Kinase	PRKACA	P17612	GPS
155	T	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
155	T	Phosphorylation	Kinase	PKA	-	Uniprot
223	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
223	S	Phosphorylation	Kinase	CK2A1	P19139	PSP
249	S	Phosphorylation	Kinase	AKT1	P31749	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
155	T	Phosphorylation	Preferentially phosphorylated at the Thr-155 by PKC in cancer cells.	15657440

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PAWR_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DAPK3_RAT	Dapk3	physical	10602480
WT1_HUMAN	WT1	physical	8943350
TFPT_RAT	Tfpt	physical	16229834

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.