UniProt ID | PAQR5_HUMAN | |
---|---|---|
UniProt AC | Q9NXK6 | |
Protein Name | Membrane progestin receptor gamma {ECO:0000303|PubMed:23763432} | |
Gene Name | PAQR5 {ECO:0000312|HGNC:HGNC:29645} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 330 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | Plasma membrane progesterone (P4) receptor coupled to G proteins. [PubMed: 23763432 Seems to act through a G(i) mediated pathway] | |
Protein Sequence | MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFWFFAWRFVTALYMTDIKNDSYSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLAFAYPYTWDSLPIFYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAILLCIIFSLSNIIYFSAALYRIPKPELHKKET | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MLSLKLPRLF -----CCCCCCCCCC | 24719451 | ||
5 | Ubiquitination | ---MLSLKLPRLFSI ---CCCCCCCCCCCH | - | ||
219 | Phosphorylation | AQNEATSYHQKHMIM HHCCCCHHHHHHHHH | 17053785 | ||
227 | Phosphorylation | HQKHMIMTLLASFLY HHHHHHHHHHHHHHH | 26546556 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAQR5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAQR5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAQR5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
PHYIP_HUMAN | PHYHIP | physical | 26186194 | |
PHYIP_HUMAN | PHYHIP | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...