UniProt ID | P24DA_ARATH | |
---|---|---|
UniProt AC | Q8VY92 | |
Protein Name | Transmembrane emp24 domain-containing protein p24delta10 | |
Gene Name | At1g69460 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 214 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane Single-pass type I membrane protein . Golgi apparatus, cis-Golgi network membrane Single-pass type I membrane protein |
|
Protein Description | Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side (By similarity).. | |
Protein Sequence | MFLQSQKLWTMLLILAIWSPISHSLHFDLHSGRTKCIAEDIKSNSMTVGKYNIDNPHEGQALPQTHKISVKVTSNSGNNYHHAEQVDSGQFAFSAVEAGDYMACFTAVDHKPEVSLSIDFEWKTGVQSKSWANVAKKSQVEVMEFEVKSLLDTVNSIHEEMYYLRDREEEMQDLNRSTNTKMAWLSVLSFFVCIGVAGMQFLHLKTFFEKKKVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P24DA_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P24DA_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P24DA_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PIP15_ARATH | PIP1;5 | physical | 24833385 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
C71B4_ARATH | CYP71B4 | physical | 24833385 | |
DERL1_ARATH | DER1 | physical | 24833385 | |
CP21D_ARATH | AT3G66654 | physical | 24833385 | |
PAM74_ARATH | AT5G59650 | physical | 24833385 | |
BET12_ARATH | ATBET12 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...