UniProt ID | OTU6A_HUMAN | |
---|---|---|
UniProt AC | Q7L8S5 | |
Protein Name | OTU domain-containing protein 6A | |
Gene Name | OTUD6A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 288 | |
Subcellular Localization | ||
Protein Description | Deubiquitinating enzyme that hydrolyzes 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains. Also able to hydrolyze 'Lys-11'-linked ubiquitin chains.. | |
Protein Sequence | MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARGLEMKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKKHVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRALSHVLKTPIEVIQADSPTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAAGGVLPRLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | O-linked_Glycosylation | QIRSLKNSVPKTDKT HHHHHHHCCCCCCHH | 37.90 | 30379171 | |
71 | Phosphorylation | EKFQDDSSIESVVED HHHCCCCCHHHHHHH | 37.05 | 18452278 | |
74 | Phosphorylation | QDDSSIESVVEDLAK CCCCCHHHHHHHHHH | 29.77 | 18452278 | |
213 | Phosphorylation | YCDNIVRTTAWGGQL EECCCCCCCCCCCHH | 15.24 | - | |
214 | Phosphorylation | CDNIVRTTAWGGQLE ECCCCCCCCCCCHHH | 15.17 | - | |
249 | Phosphorylation | TLIIGEEYVKKPIIL EEEECHHHCCCCEEH | 17.17 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTU6A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTU6A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTU6A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RING2_HUMAN | RNF2 | physical | 23105109 | |
HOIL1_HUMAN | RBCK1 | physical | 23105109 | |
CBLC_HUMAN | CBLC | physical | 23105109 | |
TRI39_HUMAN | TRIM39 | physical | 23105109 | |
TRI46_HUMAN | TRIM46 | physical | 23105109 | |
TRIM5_HUMAN | TRIM5 | physical | 23105109 | |
UBC_HUMAN | UBC | physical | 23827681 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...