UniProt ID | OTC_YEAST | |
---|---|---|
UniProt AC | P05150 | |
Protein Name | Ornithine carbamoyltransferase | |
Gene Name | ARG3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 338 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MSTTASTPSSLRHLISIKDLSDEEFRILVQRAQHFKNVFKANKTNDFQSNHLKLLGRTIALIFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVNKHEDILAFCKDSSVPIINSLCDKFHPLQAICDLLTIIENFNISLDEVNKGINSKLKMAWIGDANNVINDMCIACLKFGISVSISTPPGIEMDSDIVDEAKKVAERNGATFELTHDSLKASTNANILVTDTFVSMGEEFAKQAKLKQFKGFQINQELVSVADPNYKFMHCLPRHQEEVSDDVFYGEHSIVFEEAENRLYAAMSAIDIFVNNKGNFKDLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSTTASTPS ------CCCCCCCHH | 34.17 | 22814378 | |
2 | Phosphorylation | ------MSTTASTPS ------CCCCCCCHH | 34.17 | 22369663 | |
3 | Phosphorylation | -----MSTTASTPSS -----CCCCCCCHHH | 25.69 | 22369663 | |
4 | Phosphorylation | ----MSTTASTPSSL ----CCCCCCCHHHH | 16.00 | 22369663 | |
6 | Phosphorylation | --MSTTASTPSSLRH --CCCCCCCHHHHHH | 38.47 | 22369663 | |
7 | Phosphorylation | -MSTTASTPSSLRHL -CCCCCCCHHHHHHH | 25.40 | 22369663 | |
9 | Phosphorylation | STTASTPSSLRHLIS CCCCCCHHHHHHHHC | 41.93 | 19823750 | |
10 | Phosphorylation | TTASTPSSLRHLISI CCCCCHHHHHHHHCC | 30.53 | 22369663 | |
16 | Phosphorylation | SSLRHLISIKDLSDE HHHHHHHCCCCCCHH | 29.91 | 19823750 | |
18 | Acetylation | LRHLISIKDLSDEEF HHHHHCCCCCCHHHH | 45.91 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTC_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTC_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTC_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARGI_YEAST | CAR1 | physical | 12679340 | |
CAN1_YEAST | CAN1 | genetic | 16941010 | |
GAP1_YEAST | GAP1 | genetic | 16941010 | |
MEH1_YEAST | MEH1 | genetic | 15989961 | |
SLM4_YEAST | SLM4 | genetic | 15989961 | |
GTR2_YEAST | GTR2 | genetic | 15989961 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...