| UniProt ID | OTC_YEAST | |
|---|---|---|
| UniProt AC | P05150 | |
| Protein Name | Ornithine carbamoyltransferase | |
| Gene Name | ARG3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 338 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | ||
| Protein Sequence | MSTTASTPSSLRHLISIKDLSDEEFRILVQRAQHFKNVFKANKTNDFQSNHLKLLGRTIALIFTKRSTRTRISTEGAATFFGAQPMFLGKEDIQLGVNESFYDTTKVVSSMVSCIFARVNKHEDILAFCKDSSVPIINSLCDKFHPLQAICDLLTIIENFNISLDEVNKGINSKLKMAWIGDANNVINDMCIACLKFGISVSISTPPGIEMDSDIVDEAKKVAERNGATFELTHDSLKASTNANILVTDTFVSMGEEFAKQAKLKQFKGFQINQELVSVADPNYKFMHCLPRHQEEVSDDVFYGEHSIVFEEAENRLYAAMSAIDIFVNNKGNFKDLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSTTASTPS ------CCCCCCCHH | 34.17 | 22814378 | |
| 2 | Phosphorylation | ------MSTTASTPS ------CCCCCCCHH | 34.17 | 22369663 | |
| 3 | Phosphorylation | -----MSTTASTPSS -----CCCCCCCHHH | 25.69 | 22369663 | |
| 4 | Phosphorylation | ----MSTTASTPSSL ----CCCCCCCHHHH | 16.00 | 22369663 | |
| 6 | Phosphorylation | --MSTTASTPSSLRH --CCCCCCCHHHHHH | 38.47 | 22369663 | |
| 7 | Phosphorylation | -MSTTASTPSSLRHL -CCCCCCCHHHHHHH | 25.40 | 22369663 | |
| 9 | Phosphorylation | STTASTPSSLRHLIS CCCCCCHHHHHHHHC | 41.93 | 19823750 | |
| 10 | Phosphorylation | TTASTPSSLRHLISI CCCCCHHHHHHHHCC | 30.53 | 22369663 | |
| 16 | Phosphorylation | SSLRHLISIKDLSDE HHHHHHHCCCCCCHH | 29.91 | 19823750 | |
| 18 | Acetylation | LRHLISIKDLSDEEF HHHHHCCCCCCHHHH | 45.91 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTC_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTC_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTC_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARGI_YEAST | CAR1 | physical | 12679340 | |
| CAN1_YEAST | CAN1 | genetic | 16941010 | |
| GAP1_YEAST | GAP1 | genetic | 16941010 | |
| MEH1_YEAST | MEH1 | genetic | 15989961 | |
| SLM4_YEAST | SLM4 | genetic | 15989961 | |
| GTR2_YEAST | GTR2 | genetic | 15989961 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
