dbPTM

OFP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OFP1_ARATH
UniProt AC	Q9LZW2
Protein Name	Transcription repressor OFP1
Gene Name	OFP1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	270
Subcellular Localization	Nucleus .
Protein Description	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors. Controls the subcellular localization of the homeodomain protein BLH1. Plays a role in the regulation of cell elongation by controlling the expression of GA20OX1, a gene that encodes a key enzyme in gibberellin biosynthesis. May play a role in double-stranded DNA repair through the DNA non-homologous end joining (NHEJ) pathway along with KU70 and KU80 protein complex. Possesses DNA-binding activity towards double-stranded and single-stranded DNA in vitro..
Protein Sequence	MGNNYRFKLSELIPNAWFYKLRDMSKSKKKNLQSQPNSTTSKKKHHAVPTPTSTTPLSPRPPRRPSHSSKAPPSHPPRKSSGNRLRHRATVDSKSSTTSGDSTTTETGSFSPDFRSDQVLLPDESLTGSWHSPCSSKLSKTATFTPPPELELRPIITKTAATARKTAVNSPAGVRLRMRSPRISVSSSARRSGSSARRSRAVVKASVDPKRDFKESMEEMIAENKIRATKDLEELLACYLCLNSDEYHAIIINVFKQIWLDLNLPPPHSK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OFP1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OFP1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OFP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OFP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
OFP1_ARATH	OFP1	physical	15781858
KU70_ARATH	KU70	physical	20844935

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OFP1_ARATH

Related Literatures of Post-Translational Modification