| UniProt ID | NXT1_HUMAN | |
|---|---|---|
| UniProt AC | Q9UKK6 | |
| Protein Name | NTF2-related export protein 1 | |
| Gene Name | NXT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 140 | |
| Subcellular Localization | Nucleus. Nucleus speckle . Cytoplasm. Shuttles between the nucleus and the cytoplasm. | |
| Protein Description | Stimulator of protein export for NES-containing proteins. [PubMed: 10567585 Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA] | |
| Protein Sequence | MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASVDFKTY ------CCCCCHHHH | 20.47 | 22814378 | |
| 7 | Ubiquitination | -MASVDFKTYVDQAC -CCCCCHHHHHHHHH | 34.19 | 33845483 | |
| 30 | Ubiquitination | VYYTTMDKRRRLLSR HHEEHHHHHHHHHHH | 36.66 | 22817900 | |
| 105 | Ubiquitination | SVKFEGNKQRDFNQN CCEECCCCEECCCCC | 58.53 | 33845483 | |
| 116 | Phosphorylation | FNQNFILTAQASPSN CCCCEEEEEECCCCC | 16.35 | 27251275 | |
| 120 | Phosphorylation | FILTAQASPSNTVWK EEEEEECCCCCHHHH | 19.44 | 27690223 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NXT1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NXT1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NXT1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NXF3_HUMAN | NXF3 | physical | 16189514 | |
| VPS36_HUMAN | VPS36 | physical | 22939629 | |
| NXF3_HUMAN | NXF3 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
