NXF5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NXF5_HUMAN
• UniProt AC: Q9H1B4
• Protein Name: Nuclear RNA export factor 5
• Gene Name: NXF5
• Organism: Homo sapiens (Human).
• Sequence Length: 397
• Subcellular Localization: Cytoplasm. Nucleus. Mainly localized in the cytoplasm of cells and more particularly in the cell body and neurites of hippocampal neurons. Although nuclear localization is also observed. Not detected at nuclear rim.
• Protein Description: Could be involved in the export of mRNA from the nucleus to the cytoplasm. Could also have a role in polarized cytoplasmic transport and localization of mRNA in neurons..
• Protein Sequence: MRRNTQDENMRKWFKVTIPYGIKYDKAWLMNSIQSNCSVPFTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQSNLCKYFKDSRNIKILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQRWWCLLSLKWKDGLRVLILPSCGPSSLPLAAIPVCAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	MRKWFKVTIPYGIKY HHHHHEEEECCCCCC	19.47	26074081
20	Phosphorylation	WFKVTIPYGIKYDKA HHEEEECCCCCCCHH	27.86	26074081
74	Phosphorylation	KDVSYKIYDDENQKI HCCCEEEEECCCCEE	17.12	-
150	Phosphorylation	RRNCMAATLKITERN CCCCHHHHHHHHHHC	21.03	24719451
163	Phosphorylation	RNFPELLSLNLCNNK HCCHHHHCCCCCCCC	28.03	27461979
172	Phosphorylation	NLCNNKLYQLDGLSD CCCCCCEEECCCCCH	14.51	27461979
178	Phosphorylation	LYQLDGLSDITEKAP EEECCCCCHHHHHCC	32.28	27461979
181	Phosphorylation	LDGLSDITEKAPKVK CCCCCHHHHHCCCCC	36.10	27461979
272	Phosphorylation	KPCKENFTGSETLKH CCCCCCCCCHHHHHH	51.91	-
296 (in isoform 4)	Phosphorylation	-	42.82	23663014
298 (in isoform 4)	Phosphorylation	-	60.05	23663014
303 (in isoform 4)	Phosphorylation	-	4.35	23663014
307	Phosphorylation	IKILKDPYLQRKLLK CEECCCHHHHHHHHH	26.12	19664994
359 (in isoform 2)	Phosphorylation	-	28.33	23663014
361 (in isoform 2)	Phosphorylation	-	37.83	23663014
366 (in isoform 2)	Phosphorylation	-	5.23	23663014
367	Phosphorylation	QRWWCLLSLKWKDGL HCEEEEEEEEECCCE	18.24	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NXF5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NXF5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NXF5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSP7C_HUMAN	HSPA8	physical	26186194
HSP76_HUMAN	HSPA6	physical	26186194
TCPQ_HUMAN	CCT8	physical	26186194
TCPG_HUMAN	CCT3	physical	26186194
TCPH_HUMAN	CCT7	physical	26186194
ACTBL_HUMAN	ACTBL2	physical	28514442
ACTB_HUMAN	ACTB	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.