NREP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NREP_HUMAN
• UniProt AC: Q16612
• Protein Name: Neuronal regeneration-related protein
• Gene Name: NREP
• Organism: Homo sapiens (Human).
• Sequence Length: 68
• Subcellular Localization: Cytoplasm .
• Protein Description: May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation..
• Protein Sequence: MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MVYYPELFVW -----CCCCCCEEEE	16.41	24043423
4	Phosphorylation	----MVYYPELFVWV ----CCCCCCEEEEE	4.46	24043423
7 (in isoform 2)	Phosphorylation	-	3.47	-
12	Phosphorylation	PELFVWVSQEPFPNK CCEEEEECCCCCCCC	17.08	24043423
25 (in isoform 2)	Phosphorylation	-	8.27	26657352
31 (in isoform 2)	Phosphorylation	-	38.72	26657352
34	Acetylation	KGRLPVPKEVNRKKN CCCCCCCHHHCCCCC	74.63	19828987
59	Phosphorylation	LGSSELRSPRISYLH CCCHHHCCCCEEEEE	31.02	14702039

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
59	S	Phosphorylation	Kinase	PRKCE	Q02156	GPS
59	S	Phosphorylation	Kinase	PRKCZ	Q05513	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
59	S	Phosphorylation	Phosphorylated on Ser-59.	16229809

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NREP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IGS21_HUMAN	IGSF21	physical	16169070
KMT2B_HUMAN	KMT2B	physical	21900206
EF1A1_HUMAN	EEF1A1	physical	21900206

Drug and Disease Associations

• Kegg Disease
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.