UniProt ID | NR4A2_MOUSE | |
---|---|---|
UniProt AC | Q06219 | |
Protein Name | Nuclear receptor subfamily 4 group A member 2 | |
Gene Name | Nr4a2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 598 | |
Subcellular Localization |
Cytoplasm. Nucleus. Mostly nuclear oxidative stress promotes cytoplasmic localization.. |
|
Protein Description | Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons.. | |
Protein Sequence | MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPSTPSFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQDPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
126 | Phosphorylation | SVYYKPSSPPTPSTP CCEECCCCCCCCCCC | 43.35 | - | |
129 | Phosphorylation | YKPSSPPTPSTPSFQ ECCCCCCCCCCCCCE | 33.00 | - | |
132 | Phosphorylation | SSPPTPSTPSFQVQH CCCCCCCCCCCEEEC | 24.93 | - | |
181 | Phosphorylation | SLFSFKQSPPGTPVS EEEEECCCCCCCCCC | 33.38 | - | |
337 | Phosphorylation | KEVVRTDSLKGRRGR EEEEECCCCCCCCCC | 31.22 | 29176673 | |
351 | Phosphorylation | RLPSKPKSPQDPSPP CCCCCCCCCCCCCCC | 36.00 | 22817900 | |
356 | Phosphorylation | PKSPQDPSPPSPPVS CCCCCCCCCCCCCHH | 58.70 | 22817900 | |
359 | Phosphorylation | PQDPSPPSPPVSLIS CCCCCCCCCCHHHHH | 45.26 | 30372032 | |
363 | Phosphorylation | SPPSPPVSLISALVR CCCCCCHHHHHHHHH | 26.26 | 20415495 | |
366 | Phosphorylation | SPPVSLISALVRAHV CCCHHHHHHHHHHHC | 22.35 | 20415495 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
126 | S | Phosphorylation | Kinase | MAPK1 | P63085 | GPS |
129 | T | Phosphorylation | Kinase | MAPK1 | P63085 | GPS |
132 | T | Phosphorylation | Kinase | MAPK1 | P63085 | GPS |
185 | T | Phosphorylation | Kinase | MAPK1 | P63085 | GPS |
347 | S | Phosphorylation | Kinase | RSK-SUBFAMILY | - | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NR4A2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NR4A2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDN1C_MOUSE | Cdkn1c | physical | 14671317 | |
K1522_HUMAN | KIAA1522 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...