CDN1C_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CDN1C_MOUSE
• UniProt AC: P49919
• Protein Name: Cyclin-dependent kinase inhibitor 1C
• Gene Name: Cdkn1c
• Organism: Mus musculus (Mouse).
• Sequence Length: 348
• Subcellular Localization: Nucleus.
• Protein Description: Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life..
• Protein Sequence: MGMSDVYLRSRTAMERLASSDTFPVIARSSACRSLFGPVDHEELGRELRMRLAELNAEDQNRWDFNFQQDVPLRGPGRLQWMEVDSESVPAFYRETVQVGRCRLQLGPRPPPVAVAVIPRSGPPAGEAPDGLEEAPEQPPSAPASAVVAEPTPPATPAPASDLTSDPIPEVTLVATSDPTPDPIPDANPDVATRDGEEQVPEQVSEQGEESGAEPGDELGTEPVSEQGEEQGAEPVEEKDEEPEEEQGAEPVEEQGAEPVEEQNGEPVEEQDENQEQRGQELKDQPLSGIPGRPAPGTAAANANDFFAKRKRTAQENKASNDVPPGCPSPNVAPGVGAVEQTPRKRLR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	TAMERLASSDTFPVI HHHHHHHCCCCHHHH	33.08	21791608
20	Phosphorylation	AMERLASSDTFPVIA HHHHHHCCCCHHHHC	34.75	22942356
109	Methylation	CRLQLGPRPPPVAVA EEEECCCCCCCEEEE	55.34	24129315
156	Phosphorylation	AEPTPPATPAPASDL ECCCCCCCCCCHHHC	26.25	-
342	Phosphorylation	GVGAVEQTPRKRLR- CCCCCCCCCCHHCC-	16.14	12753918

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
19	S	Phosphorylation	Kinase	CHEK1	O14757	GPS
-	K	Ubiquitination	E3 ubiquitin ligase	Fbxl12	Q9EPX5	PMID:22199232
-	K	Ubiquitination	E3 ubiquitin ligase	Skp2	Q9Z0Z3	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CDN1C_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CDN1C_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NR4A2_MOUSE	Nr4a2	physical	14671317

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.