dbPTM

NNRD_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NNRD_SCHPO
UniProt AC	O94347
Protein Name	ATP-dependent (S)-NAD(P)H-hydrate dehydratase {ECO:0000255\|HAMAP-Rule:MF_03157}
Gene Name	SPCC61.03
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	327
Subcellular Localization	Cytoplasm .
Protein Description	Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration..
Protein Sequence	MTSGSPKITNLLTRVKRIIPPLLDTFHKGQAGRVGVFGGCQHYTGAPYYSSMSSMLFGSDQSHIFCEKEAANVIKSYSPDLIVHPFLREKDKAGPEDSVDKCFELIKPMMGRLHAIVIGPGLGRDEWMQEIMAKVIEYARKNDMPMVIDADGLWLIQQRPELVSGYHNVILTPNVIEFKRLCDKLDIKSDGPDACNQLAGKLNLLIIQKGQSDIISDGATAYACSVPGGLKRCGGQGDILTGILATFLAWRHAYLSKEWDTEGNMDAKECLFLAAFGASACTRWCSRLAFKECGRATQSTDLVRHVGKAYNALMEDEIPSVEEKIKD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NNRD_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NNRD_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NNRD_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NNRD_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELL1_SCHPO	ell1	genetic	22681890
MU124_SCHPO	mug124	genetic	22681890
BQT3_SCHPO	bqt3	genetic	22681890
YJ52_SCHPO	SPCP20C8.02c	genetic	22681890
XPOT_SCHPO	los1	genetic	22681890
SEY1_SCHPO	SPAC222.14c	genetic	22681890
PNG1_SCHPO	SPBC1709.14	genetic	22681890
YK72_SCHPO	SPAC732.02c	genetic	22681890
GET4_SCHPO	get4	genetic	22681890
NNRD_SCHPO	SPCC61.03	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NNRD_SCHPO

Related Literatures of Post-Translational Modification