NLTP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NLTP1_ARATH
• UniProt AC: Q42589
• Protein Name: Non-specific lipid-transfer protein 1
• Gene Name: LTP1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 118
• Subcellular Localization: Secreted, cell wall .
• Protein Description: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues..
• Protein Sequence: MAGVMKLACLLLACMIVAGPITSNAALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNLNSIAKTTPDRQQACNCIQGAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTVR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of NLTP1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NLTP1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NLTP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NLTP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CALM1_ARATH	CAM1	physical	15757661
CALM4_ARATH	CAM1	physical	15757661

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.