CALM1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CALM1_ARATH
• UniProt AC: P0DH95
• Protein Name: Calmodulin-1
• Gene Name: CAM1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 149
• Subcellular Localization: Cytoplasm . Cell membrane . Localizes to the plasma membrane when interacting with ZAR1.
• Protein Description: Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases..
• Protein Sequence: MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MADQLTDEQISEF --CCCCCCHHHHHHH	31.68	25368622
18	Phosphorylation	SEFKEAFSLFDKDGD HHHHHHHHCCCCCCC	34.86	30589143
80	Phosphorylation	MAKKMKDTDSEEELK HHHHHCCCCCHHHHH	35.59	30291188
82	Phosphorylation	KKMKDTDSEEELKEA HHHCCCCCHHHHHHH	49.34	30291188
102	Phosphorylation	KDQNGFISAAELRHV CCCCCCCCHHHHHHH	21.11	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CALM1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CALM1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CALM1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UPS1_ARATH	UPS1	physical	22737156
TIC32_ARATH	AT4G23430	physical	19523112
GTL2_ARATH	AT5G28300	physical	22325890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.