UniProt ID | CALM4_ARATH | |
---|---|---|
UniProt AC | P0DH96 | |
Protein Name | Calmodulin-4 | |
Gene Name | CAM4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 149 | |
Subcellular Localization | ||
Protein Description | Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Activates MPK8 through direct binding and in an calcium-dependent manner.. | |
Protein Sequence | MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MADQLTDEQISEF --CCCCCCHHHHHHH | 31.68 | 25368622 | |
18 | Phosphorylation | SEFKEAFSLFDKDGD HHHHHHHHCCCCCCC | 34.86 | 30589143 | |
80 | Phosphorylation | MAKKMKDTDSEEELK HHHHHCCCCCHHHHH | 35.59 | 30291188 | |
82 | Phosphorylation | KKMKDTDSEEELKEA HHHCCCCCHHHHHHH | 49.34 | 30291188 | |
102 | Phosphorylation | KDQNGFISAAELRHV CCCCCCCCHHHHHHH | 21.11 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALM4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALM4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALM4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UPS1_ARATH | UPS1 | physical | 22737156 | |
TIC32_ARATH | AT4G23430 | physical | 19523112 | |
GTL2_ARATH | AT5G28300 | physical | 22325890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...