dbPTM

CALM4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CALM4_ARATH
UniProt AC	P0DH96
Protein Name	Calmodulin-4
Gene Name	CAM4
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	149
Subcellular Localization
Protein Description	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Activates MPK8 through direct binding and in an calcium-dependent manner..
Protein Sequence	MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MADQLTDEQISEF --CCCCCCHHHHHHH	31.68	25368622
18	Phosphorylation	SEFKEAFSLFDKDGD HHHHHHHHCCCCCCC	34.86	30589143
80	Phosphorylation	MAKKMKDTDSEEELK HHHHHCCCCCHHHHH	35.59	30291188
82	Phosphorylation	KKMKDTDSEEELKEA HHHCCCCCHHHHHHH	49.34	30291188
102	Phosphorylation	KDQNGFISAAELRHV CCCCCCCCHHHHHHH	21.11	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CALM4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CALM4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CALM4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UPS1_ARATH	UPS1	physical	22737156
TIC32_ARATH	AT4G23430	physical	19523112
GTL2_ARATH	AT5G28300	physical	22325890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CALM4_ARATH

Related Literatures of Post-Translational Modification