UniProt ID | NKX32_HUMAN | |
---|---|---|
UniProt AC | P78367 | |
Protein Name | Homeobox protein Nkx-3.2 | |
Gene Name | NKX3-2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 333 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus (By similarity).. | |
Protein Sequence | MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MAVRGANTLTSFSIQ CCCCCCCCCCHHHHH | 30.77 | 23090842 | |
10 | Phosphorylation | VRGANTLTSFSIQAI CCCCCCCCHHHHHHH | 26.20 | 23090842 | |
11 | Phosphorylation | RGANTLTSFSIQAIL CCCCCCCHHHHHHHH | 21.80 | 22199227 | |
13 | Phosphorylation | ANTLTSFSIQAILNK CCCCCHHHHHHHHCC | 17.35 | 23090842 | |
84 | Phosphorylation | TRTAAGRTAESPEGW CCCCCCCCCCCCCCC | 33.58 | - | |
93 | Phosphorylation | ESPEGWDSDSALSEE CCCCCCCCCHHCCHH | 27.27 | - | |
146 | Phosphorylation | EEEAAGRSDSEMSAS HHHHCCCCCCHHCHH | 44.57 | 26699800 | |
148 | Phosphorylation | EAAGRSDSEMSASVS HHCCCCCCHHCHHCC | 36.12 | 26699800 | |
151 | Phosphorylation | GRSDSEMSASVSGDR CCCCCHHCHHCCCCC | 17.22 | 26699800 | |
153 | Phosphorylation | SDSEMSASVSGDRSP CCCHHCHHCCCCCCC | 14.98 | 26699800 | |
155 | Phosphorylation | SEMSASVSGDRSPRT CHHCHHCCCCCCCCC | 32.26 | 26699800 | |
159 | Phosphorylation | ASVSGDRSPRTEDDG HHCCCCCCCCCCCCC | 24.39 | 17081983 | |
273 | Phosphorylation | MAADLLASAPAAKKV HHHHHHHCCHHHHHE | 34.45 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NKX32_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NKX32_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NKX32_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMAD1_HUMAN | SMAD1 | physical | 14612411 | |
SMAD4_HUMAN | SMAD4 | physical | 14612411 | |
HDAC1_HUMAN | HDAC1 | physical | 14612411 | |
SIN3A_HUMAN | SIN3A | physical | 14612411 | |
RBBP7_HUMAN | RBBP7 | physical | 14612411 | |
RBBP4_HUMAN | RBBP4 | physical | 14612411 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...