UniProt ID | NGN2_MOUSE | |
---|---|---|
UniProt AC | P70447 | |
Protein Name | Neurogenin-2 | |
Gene Name | Neurog2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 263 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3').. | |
Protein Sequence | MFVKSETLELKEEEEVLMLLGSASPASATLTPMSSSADEEEDEELRRPGSARGQRGAEAEQGVQGSPASGAGGCRPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCAGAGGLQGALFTEAVLLSPGAALGASGDSPSPPSSWSCTNSPASSSNSTSPYSCTLSPASPGSDVDYWQPPPPEKHRYAPHLPLARDCI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
91 | Phosphorylation | HECKRRPSRSRAVSR HHHHCCCCHHHHHHH | 40.87 | 20531401 | |
93 | Phosphorylation | CKRRPSRSRAVSRGA HHCCCCHHHHHHHCC | 29.00 | 20531401 | |
231 | Phosphorylation | SPYSCTLSPASPGSD CCCEEEECCCCCCCC | 10.56 | 18400164 | |
234 | Phosphorylation | SCTLSPASPGSDVDY EEEECCCCCCCCCCC | 32.93 | 18400164 | |
241 | Phosphorylation | SPGSDVDYWQPPPPE CCCCCCCCCCCCCCC | 13.04 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
231 | S | Phosphorylation | Kinase | GSK3A | P49840 | PSP |
231 | S | Phosphorylation | Kinase | GSK3A | Q2NL51 | PSP |
231 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
231 | S | Phosphorylation | Kinase | GSK3B | Q9WV60 | PSP |
234 | S | Phosphorylation | Kinase | GSK3A | P49840 | PSP |
234 | S | Phosphorylation | Kinase | GSK3A | Q2NL51 | PSP |
234 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
234 | S | Phosphorylation | Kinase | GSK3B | Q9WV60 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NGN2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NGN2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ASCL1_MOUSE | Ascl1 | physical | 20211142 | |
TFE2_MOUSE | Tcf3 | physical | 8948587 | |
ASCL1_MOUSE | Ascl1 | physical | 8948587 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...