NGN2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NGN2_MOUSE
• UniProt AC: P70447
• Protein Name: Neurogenin-2
• Gene Name: Neurog2
• Organism: Mus musculus (Mouse).
• Sequence Length: 263
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3')..
• Protein Sequence: MFVKSETLELKEEEEVLMLLGSASPASATLTPMSSSADEEEDEELRRPGSARGQRGAEAEQGVQGSPASGAGGCRPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCAGAGGLQGALFTEAVLLSPGAALGASGDSPSPPSSWSCTNSPASSSNSTSPYSCTLSPASPGSDVDYWQPPPPEKHRYAPHLPLARDCI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
91	Phosphorylation	HECKRRPSRSRAVSR HHHHCCCCHHHHHHH	40.87	20531401
93	Phosphorylation	CKRRPSRSRAVSRGA HHCCCCHHHHHHHCC	29.00	20531401
231	Phosphorylation	SPYSCTLSPASPGSD CCCEEEECCCCCCCC	10.56	18400164
234	Phosphorylation	SCTLSPASPGSDVDY EEEECCCCCCCCCCC	32.93	18400164
241	Phosphorylation	SPGSDVDYWQPPPPE CCCCCCCCCCCCCCC	13.04	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
231	S	Phosphorylation	Kinase	GSK3A	P49840	PSP
231	S	Phosphorylation	Kinase	GSK3A	Q2NL51	PSP
231	S	Phosphorylation	Kinase	GSK3B	P49841	PSP
231	S	Phosphorylation	Kinase	GSK3B	Q9WV60	PSP
234	S	Phosphorylation	Kinase	GSK3A	P49840	PSP
234	S	Phosphorylation	Kinase	GSK3A	Q2NL51	PSP
234	S	Phosphorylation	Kinase	GSK3B	P49841	PSP
234	S	Phosphorylation	Kinase	GSK3B	Q9WV60	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NGN2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NGN2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ASCL1_MOUSE	Ascl1	physical	20211142
TFE2_MOUSE	Tcf3	physical	8948587
ASCL1_MOUSE	Ascl1	physical	8948587

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.