dbPTM

NGB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NGB_HUMAN
UniProt AC	Q9NPG2
Protein Name	Neuroglobin
Gene Name	NGB
Organism	Homo sapiens (Human).
Sequence Length	151
Subcellular Localization	Perikaryon. Cytoplasm. Mitochondrion.
Protein Description	Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis..
Protein Sequence	MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
57	Phosphorylation	SSPEDCLSSPEFLDH CCHHHHHCCHHHHHH	50.61	22468782
77	Phosphorylation	LVIDAAVTNVEDLSS HHHHHHCCCHHHHHH	28.90	22468782

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NGB_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NGB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NGB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GNAO_HUMAN	GNAO1	physical	12860983
FLOT1_HUMAN	FLOT1	physical	15939299
LMBL3_HUMAN	L3MBTL3	physical	25416956
CA094_HUMAN	C1orf94	physical	25416956
IHO1_HUMAN	CCDC36	physical	25416956
AKT1_HUMAN	AKT1	physical	23904011
MPP2_HUMAN	MPP2	physical	28514442
TRI32_HUMAN	TRIM32	physical	28514442
CCNB1_HUMAN	CCNB1	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NGB_HUMAN

Related Literatures of Post-Translational Modification