UniProt ID | NEDD8_DROME | |
---|---|---|
UniProt AC | Q9VJ33 | |
Protein Name | NEDD8 | |
Gene Name | Nedd8 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 84 | |
Subcellular Localization | Nucleus. Mainly nuclear.. | |
Protein Description | Ubiquitin-like protein which plays an important role in cell cycle control, embryogenesis and neurogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex Uba3-Ula1 and linkage to the E2 enzyme Ubc12. Attachment of Nedd8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.. | |
Protein Sequence | MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVLHLVLALRGGDSILTPCV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Acetylation | QRLIFSGKQMNDDKT HEEEEECCCCCCCCC | 45.21 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEDD8_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEDD8_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEDD8_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTRO_DROME | Patronin | physical | 14605208 | |
DRICE_DROME | Ice | physical | 21145488 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...