UniProt ID | NDK6_HUMAN | |
---|---|---|
UniProt AC | O75414 | |
Protein Name | Nucleoside diphosphate kinase 6 | |
Gene Name | NME6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 186 | |
Subcellular Localization | ||
Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Inhibitor of p53-induced apoptosis.. | |
Protein Sequence | MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
84 | Phosphorylation | ASGPIRAYILAHKDA HCCHHHHHEEHHHHH | 6.14 | 22210691 | |
102 | Phosphorylation | WRTLMGPTRVFRARH HHHHHCCCEEEEEEE | 33.46 | 22210691 | |
114 | Phosphorylation | ARHVAPDSIRGSFGL EEEECCCCCCCCCCC | 17.08 | 27251275 | |
122 | Phosphorylation | IRGSFGLTDTRNTTH CCCCCCCCCCCCCCC | 35.39 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
SSA27_HUMAN | SSSCA1 | physical | 21988832 | |
RCC1L_HUMAN | WBSCR16 | physical | 21988832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...