NDK6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDK6_HUMAN
• UniProt AC: O75414
• Protein Name: Nucleoside diphosphate kinase 6
• Gene Name: NME6
• Organism: Homo sapiens (Human).
• Sequence Length: 186
• Protein Description: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Inhibitor of p53-induced apoptosis..
• Protein Sequence: MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
84	Phosphorylation	ASGPIRAYILAHKDA HCCHHHHHEEHHHHH	6.14	22210691
102	Phosphorylation	WRTLMGPTRVFRARH HHHHHCCCEEEEEEE	33.46	22210691
114	Phosphorylation	ARHVAPDSIRGSFGL EEEECCCCCCCCCCC	17.08	27251275
122	Phosphorylation	IRGSFGLTDTRNTTH CCCCCCCCCCCCCCC	35.39	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDK6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDK6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDK6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
SSA27_HUMAN	SSSCA1	physical	21988832
RCC1L_HUMAN	WBSCR16	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.