| UniProt ID | NBL1_HUMAN | |
|---|---|---|
| UniProt AC | P41271 | |
| Protein Name | Neuroblastoma suppressor of tumorigenicity 1 | |
| Gene Name | NBL1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 181 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process.. | |
| Protein Sequence | MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Ubiquitination | AAPPPINKLALFPDK HCCCCCCCCCCCCCH | 4.29 | - | |
| 34 | Phosphorylation | LFPDKSAWCEAKNIT CCCCHHHHHHHCCCC | 3.49 | - | |
| 34 (in isoform 2) | Phosphorylation | - | 3.49 | - | |
| 76 | O-linked_Glycosylation | PNTFPQSTESLVHCD CCCCCCCCCCCEECC | 47.53 | OGP | |
| 78 | O-linked_Glycosylation | TFPQSTESLVHCDSC CCCCCCCCCEECCCC | 2.19 | OGP | |
| 148 | O-linked_Glycosylation | GPGSQPGTHPHPHPH CCCCCCCCCCCCCCC | 25.29 | OGP |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NBL1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NBL1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NBL1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBQL1_HUMAN | UBQLN1 | physical | 9303440 | |
| NCS1_HUMAN | NCS1 | physical | 25416956 | |
| UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
| ZMIZ2_HUMAN | ZMIZ2 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
