UniProt ID | NBL1_HUMAN | |
---|---|---|
UniProt AC | P41271 | |
Protein Name | Neuroblastoma suppressor of tumorigenicity 1 | |
Gene Name | NBL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 181 | |
Subcellular Localization | Secreted. | |
Protein Description | Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process.. | |
Protein Sequence | MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Ubiquitination | AAPPPINKLALFPDK HCCCCCCCCCCCCCH | 4.29 | - | |
34 | Phosphorylation | LFPDKSAWCEAKNIT CCCCHHHHHHHCCCC | 3.49 | - | |
34 (in isoform 2) | Phosphorylation | - | 3.49 | - | |
76 | O-linked_Glycosylation | PNTFPQSTESLVHCD CCCCCCCCCCCEECC | 47.53 | OGP | |
78 | O-linked_Glycosylation | TFPQSTESLVHCDSC CCCCCCCCCEECCCC | 2.19 | OGP | |
148 | O-linked_Glycosylation | GPGSQPGTHPHPHPH CCCCCCCCCCCCCCC | 25.29 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NBL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NBL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NBL1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBQL1_HUMAN | UBQLN1 | physical | 9303440 | |
NCS1_HUMAN | NCS1 | physical | 25416956 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
ZMIZ2_HUMAN | ZMIZ2 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...