UniProt ID | MYOZ3_HUMAN | |
---|---|---|
UniProt AC | Q8TDC0 | |
Protein Name | Myozenin-3 | |
Gene Name | MYOZ3 {ECO:0000312|HGNC:HGNC:18565} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 251 | |
Subcellular Localization | Cytoplasm, myofibril, sarcomere, Z line. Localized at the Z-line of skeletal muscle.. | |
Protein Description | Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.. | |
Protein Sequence | MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALAPGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | LDLGKKLSVPQDLMM CCCCCCCCCCHHHHH | 40.40 | 23828894 | |
42 | Phosphorylation | DLMMEELSLRNNRGS HHHHHHHHHHCCCCC | 28.67 | 23828894 | |
49 | Phosphorylation | SLRNNRGSLLFQKRQ HHHCCCCCHHHHHHH | 20.75 | 26437602 | |
77 | Phosphorylation | QRAMLAGSARRKVTG HHHHHHHHCCCCCCC | 17.00 | 26437602 | |
102 | Phosphorylation | NGPEGPNYRSELHIF CCCCCCCCCCEEEEE | 20.74 | - | |
104 | Phosphorylation | PEGPNYRSELHIFPA CCCCCCCCEEEEEEC | 33.86 | 26437602 | |
112 | Phosphorylation | ELHIFPASPGASLGG EEEEEECCCCCCCCC | 24.89 | 26437602 | |
135 | Phosphorylation | APAGCVPSPSALAPG CCCCCCCCHHHCCCC | 15.87 | 26437602 | |
154 | Ubiquitination | LKGVPPEKFNHTAIS CCCCCHHHCCCCCCC | 58.18 | 30230243 | |
183 | Phosphorylation | DYQSDGRSHTPSPND CCCCCCCCCCCCCCC | 36.92 | 26437602 | |
185 | Phosphorylation | QSDGRSHTPSPNDYR CCCCCCCCCCCCCCC | 27.06 | 26437602 | |
187 | Phosphorylation | DGRSHTPSPNDYRNF CCCCCCCCCCCCCCC | 37.17 | 26437602 | |
209 | Phosphorylation | GGPLVGGTFPRPGTP CCCCCCCCCCCCCCC | 25.25 | - | |
215 | Phosphorylation | GTFPRPGTPFIPEPL CCCCCCCCCCCCCCC | 20.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYOZ3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYOZ3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYOZ3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TELT_HUMAN | TCAP | physical | 11842093 | |
FLNC_HUMAN | FLNC | physical | 11842093 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...