| UniProt ID | MUC24_HUMAN | |
|---|---|---|
| UniProt AC | Q04900 | |
| Protein Name | Sialomucin core protein 24 | |
| Gene Name | CD164 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 197 | |
| Subcellular Localization |
Lysosome membrane Single-pass type I membrane protein . Endosome membrane Single-pass type I membrane protein . Cell membrane Single-pass type I membrane protein . Isoform 2: Secreted . |
|
| Protein Description | Sialomucin that may play a key role in hematopoiesis by facilitating the adhesion of CD34(+) cells to the stroma and by negatively regulating CD34(+)CD38(lo/-) cell proliferation. Modulates the migration of umbilical cord blood CD133+ cells and this is mediated through the CXCL12/CXCR4 axis. May play an important role in prostate cancer metastasis and the infiltration of bone marrow by cancer cells. Promotes myogenesis by enhancing CXCR4-dependent cell motility. Positively regulates myoblast migration and promotes myoblast fusion into myotubes (By similarity).. | |
| Protein Sequence | MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | N-linked_Glycosylation | CVLSADKNTTQHPNV HHHCCCCCCCCCCCE | 49.24 | UniProtKB CARBOHYD | |
| 32 | N-linked_Glycosylation | KNTTQHPNVTTLAPI CCCCCCCCEEEEEEC | 41.46 | UniProtKB CARBOHYD | |
| 41 | N-linked_Glycosylation | TTLAPISNVTSAPVT EEEEECCCCCCCCCC | 41.63 | UniProtKB CARBOHYD | |
| 48 | O-linked_Glycosylation | NVTSAPVTSLPLVTT CCCCCCCCCCCEEEC | 24.40 | OGP | |
| 54 | O-linked_Glycosylation | VTSLPLVTTPAPETC CCCCCEEECCCCCCC | 34.44 | OGP | |
| 72 | N-linked_Glycosylation | NSCVSCFNVSVVNTT CCEECEEEEEEEEEE | 29.49 | UniProtKB CARBOHYD | |
| 77 | N-linked_Glycosylation | CFNVSVVNTTCFWIE EEEEEEEEEEEEEEE | 27.75 | UniProtKB CARBOHYD | |
| 79 | O-linked_Glycosylation | NVSVVNTTCFWIECK EEEEEEEEEEEEEEC | 10.66 | OGP | |
| 94 | N-linked_Glycosylation | DESYCSHNSTVSDCQ CCCCCCCCCCCCCCC | 24.07 | UniProtKB CARBOHYD | |
| 104 | N-linked_Glycosylation | VSDCQVGNTTDFCSV CCCCCCCCCCCCCCE | 40.73 | UniProtKB CARBOHYD | |
| 121 | N-linked_Glycosylation | ATPVPTANSTAKPTV CCCCCCCCCCCCCCC | 42.23 | UniProtKB CARBOHYD | |
| 127 | O-linked_Glycosylation | ANSTAKPTVQPSPST CCCCCCCCCCCCCCC | 30.94 | OGP | |
| 127 | Phosphorylation | ANSTAKPTVQPSPST CCCCCCCCCCCCCCC | 30.94 | 24043423 | |
| 131 | Phosphorylation | AKPTVQPSPSTTSKT CCCCCCCCCCCCCEE | 17.87 | 24043423 | |
| 133 | Phosphorylation | PTVQPSPSTTSKTVT CCCCCCCCCCCEEEE | 48.97 | 24043423 | |
| 134 | Phosphorylation | TVQPSPSTTSKTVTT CCCCCCCCCCEEEEC | 38.17 | 24043423 | |
| 135 | Phosphorylation | VQPSPSTTSKTVTTS CCCCCCCCCEEEECC | 32.34 | 24719451 | |
| 136 | Phosphorylation | QPSPSTTSKTVTTSG CCCCCCCCEEEECCC | 26.81 | 25159151 | |
| 142 | O-linked_Glycosylation | TSKTVTTSGTTNNTV CCEEEECCCCCCCEE | 25.44 | - | |
| 146 | N-linked_Glycosylation | VTTSGTTNNTVTPTS EECCCCCCCEECCCC | 41.85 | UniProtKB CARBOHYD | |
| 187 | S-palmitoylation | IFFLYKFCKSKERNY HHHHHHHHHHHCCCC | 4.21 | 29575903 | |
| 190 | Ubiquitination | LYKFCKSKERNYHTL HHHHHHHHCCCCCCC | 46.30 | - | |
| 194 | Phosphorylation | CKSKERNYHTL---- HHHHCCCCCCC---- | 11.47 | 28796482 | |
| 196 | Phosphorylation | SKERNYHTL------ HHCCCCCCC------ | 24.65 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MUC24_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MUC24_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MUC24_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
