dbPTM

MTX_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTX_ARATH
UniProt AC	O64471
Protein Name	Mitochondrial outer membrane import complex protein METAXIN
Gene Name	MTX1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	315
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein . Mitochondrion outer membrane Multi-pass membrane protein . The inner membrane localization is based on mass spectrometry identification and may be the result of sample contamination.
Protein Description	Involved in transport of proteins into the mitochondrion..
Protein Sequence	MEGDQETNVYTLVARKPSFDLPTACPNCLPAYIYLKLAQLPFELAFNSTFPDSDELPYFESDTYVAYNNEDGGVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTEGISTSKIYYSDLPWVISKVLFYKQTYLAKNRLGITKENAEQREKQIYKRASEAYEALSTRLGEQKFLFEDRPSSLDAFLLSHILFIIQALPVTSVLRCKLLEHSNLVRYAEKLKSEFLEASSSSPSPPLHSFPSSFPRKSSKPKSKPKVEKTEEEKKFKKRARFFLAAQFLAVVIYVSVMGGGSSDELEYEDEDD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
1	Acetylation	-------MEGDQETN -------CCCCCCCC		22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTX_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTX_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTX_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BH047_ARATH	PYE	physical	21798944
AOX1_SOYBN	AOX1	physical	17981999
ATP7_ARATH	MGP1	physical	17981999
TO401_ARATH	TOM40	physical	17981999
GSHRP_ARATH	GR	physical	17981999

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTX_ARATH

Related Literatures of Post-Translational Modification