UniProt ID | MTX_ARATH | |
---|---|---|
UniProt AC | O64471 | |
Protein Name | Mitochondrial outer membrane import complex protein METAXIN | |
Gene Name | MTX1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 315 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . Mitochondrion outer membrane Multi-pass membrane protein . The inner membrane localization is based on mass spectrometry identification and may be the result of sample contamination. |
|
Protein Description | Involved in transport of proteins into the mitochondrion.. | |
Protein Sequence | MEGDQETNVYTLVARKPSFDLPTACPNCLPAYIYLKLAQLPFELAFNSTFPDSDELPYFESDTYVAYNNEDGGVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTEGISTSKIYYSDLPWVISKVLFYKQTYLAKNRLGITKENAEQREKQIYKRASEAYEALSTRLGEQKFLFEDRPSSLDAFLLSHILFIIQALPVTSVLRCKLLEHSNLVRYAEKLKSEFLEASSSSPSPPLHSFPSSFPRKSSKPKSKPKVEKTEEEKKFKKRARFFLAAQFLAVVIYVSVMGGGSSDELEYEDEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEGDQETN -------CCCCCCCC | 22223895 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTX_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTX_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTX_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BH047_ARATH | PYE | physical | 21798944 | |
AOX1_SOYBN | AOX1 | physical | 17981999 | |
ATP7_ARATH | MGP1 | physical | 17981999 | |
TO401_ARATH | TOM40 | physical | 17981999 | |
GSHRP_ARATH | GR | physical | 17981999 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...