ATP7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATP7_ARATH
• UniProt AC: Q9SJ12
• Protein Name: Probable ATP synthase 24 kDa subunit, mitochondrial
• Gene Name: At2g21870
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 240
• Subcellular Localization: Mitochondrion. Mitochondrion inner membrane.
• Protein Description: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain (By similarity)..
• Protein Sequence: MAYASRFLSRSKQLQGGLVILQQQHAIPVRAFAKEAARPTFKGDEMLKGVFFDIKNKFQAAVDILRKEKITLDPEDPAAVKQYANVMKTIRQKADMFSESQRIKHDIDTETQDIPDARAYLLKLQEIRTRRGLTDELGAEAMMFEALEKVEKDIKKPLLRSDKKGMDLLVAEFEKGNKKLGIRKEDLPKYEENLELSMAKAQLDELKSDAVEAMESQKKKEEFQDEEMPDVKSLDIRNFI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Acetylation	KGVFFDIKNKFQAAV HHHEEECCHHHHHHH	56.80	24727099
96	Sulfoxidation	TIRQKADMFSESQRI HHHHHHHCCCHHHHH	4.81	23289948
123	Acetylation	DARAYLLKLQEIRTR HHHHHHHHHHHHHHH	45.59	24727099
175	Acetylation	LLVAEFEKGNKKLGI EEEEEECCCCHHCCC	73.44	24727099
200	Acetylation	NLELSMAKAQLDELK HHHHHHHHHHHHHHH	28.20	24727099
214	Sulfoxidation	KSDAVEAMESQKKKE HHHHHHHHHHHHHHH	3.01	23289948
228	Sulfoxidation	EEFQDEEMPDVKSLD HHHCCCCCCCCCCCC	3.02	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATP7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATP7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATP7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUMO3_ARATH	SUMO3	physical	20855607
SUMO1_ARATH	SUMO1	physical	20855607

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.