UniProt ID | MTPN_HUMAN | |
---|---|---|
UniProt AC | P58546 | |
Protein Name | Myotrophin | |
Gene Name | MTPN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 118 | |
Subcellular Localization | Cytoplasm . Nucleus. Cytoplasm, perinuclear region. | |
Protein Description | Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity (By similarity). Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy.. | |
Protein Sequence | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MCDKEFMWA ------CCCHHHHHH | 11.71 | - | |
4 | Acetylation | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | 19608861 | |
4 | Ubiquitination | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | 19608861 | |
4 | 2-Hydroxyisobutyrylation | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | - | |
11 | Acetylation | KEFMWALKNGDLDEV HHHHHHHHCCCHHHH | 51.65 | 19608861 | |
11 | Ubiquitination | KEFMWALKNGDLDEV HHHHHHHHCCCHHHH | 51.65 | 21890473 | |
19 | 2-Hydroxyisobutyrylation | NGDLDEVKDYVAKGE CCCHHHHHHHHHCCC | 41.09 | - | |
19 | Ubiquitination | NGDLDEVKDYVAKGE CCCHHHHHHHHHCCC | 41.09 | - | |
19 | Sumoylation | NGDLDEVKDYVAKGE CCCHHHHHHHHHCCC | 41.09 | - | |
19 | Acetylation | NGDLDEVKDYVAKGE CCCHHHHHHHHHCCC | 41.09 | 26051181 | |
21 | Phosphorylation | DLDEVKDYVAKGEDV CHHHHHHHHHCCCCC | 9.15 | 28152594 | |
24 | Ubiquitination | EVKDYVAKGEDVNRT HHHHHHHCCCCCCCH | 53.43 | 21906983 | |
24 | Acetylation | EVKDYVAKGEDVNRT HHHHHHHCCCCCCCH | 53.43 | 19608861 | |
31 | Phosphorylation | KGEDVNRTLEGGRKP CCCCCCCHHCCCCCC | 24.77 | 23401153 | |
66 | Acetylation | ADINAPDKHHITPLL CCCCCCCHHCCHHHH | 35.70 | 23749302 | |
66 | Ubiquitination | ADINAPDKHHITPLL CCCCCCCHHCCHHHH | 35.70 | - | |
66 | Malonylation | ADINAPDKHHITPLL CCCCCCCHHCCHHHH | 35.70 | 26320211 | |
89 | Phosphorylation | SCVKLLLSKGADKTV HHHHHHHHCCCCCCE | 29.07 | 28348404 | |
90 | 2-Hydroxyisobutyrylation | CVKLLLSKGADKTVK HHHHHHHCCCCCCEE | 59.07 | - | |
90 | Succinylation | CVKLLLSKGADKTVK HHHHHHHCCCCCCEE | 59.07 | 23954790 | |
90 | Ubiquitination | CVKLLLSKGADKTVK HHHHHHHCCCCCCEE | 59.07 | - | |
94 | 2-Hydroxyisobutyrylation | LLSKGADKTVKGPDG HHHCCCCCCEECCCC | 55.47 | - | |
97 | Ubiquitination | KGADKTVKGPDGLTA CCCCCCEECCCCCEE | 70.70 | 19608861 | |
97 | Acetylation | KGADKTVKGPDGLTA CCCCCCEECCCCCEE | 70.70 | 23954790 | |
114 | Ubiquitination | ATDNQAIKALLQ--- CCCHHHHHHHHC--- | 35.68 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTPN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTPN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTPN_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TF65_HUMAN | RELA | physical | 11971907 | |
NFKB1_HUMAN | NFKB1 | physical | 11971907 | |
REL_HUMAN | REL | physical | 11971907 | |
NPL4_HUMAN | NPLOC4 | physical | 22939629 | |
DPY30_HUMAN | DPY30 | physical | 26344197 | |
GARS_HUMAN | GARS | physical | 26344197 | |
NPL4_HUMAN | NPLOC4 | physical | 26344197 | |
PI42A_HUMAN | PIP4K2A | physical | 26344197 | |
PI42C_HUMAN | PIP4K2C | physical | 26344197 | |
UBA1_HUMAN | UBA1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT CYS-2; LYS-4; LYS-11; LYS-24 ANDLYS-97, AND MASS SPECTROMETRY. |