dbPTM

MTCU2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTCU2_YEAST
UniProt AC	P0CX81
Protein Name	Copper metallothionein 1-2
Gene Name	CUP1-2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	61
Subcellular Localization
Protein Description	Protects the cell against copper toxicity by tightly chelating copper ions. May also act as a depository for copper designated for the effective transfer into the apo forms of copper proteins..
Protein Sequence	MFSELINFQNEGHECQCQCGSCKNNEQCQKSCSCPTGCNSDDKCPCGNKSEETKKSCCSGK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Ubiquitination	KNNEQCQKSCSCPTG CCHHHHHHHCCCCCC	62.14	23749301
31	Phosphorylation	NNEQCQKSCSCPTGC CHHHHHHHCCCCCCC	5.84	23749301
33	Phosphorylation	EQCQKSCSCPTGCNS HHHHHHCCCCCCCCC	30.17	27214570
36	Phosphorylation	QKSCSCPTGCNSDDK HHHCCCCCCCCCCCC	59.71	23749301
40	Phosphorylation	SCPTGCNSDDKCPCG CCCCCCCCCCCCCCC	51.79	21440633
43	Ubiquitination	TGCNSDDKCPCGNKS CCCCCCCCCCCCCCC	45.10	23749301
49	Ubiquitination	DKCPCGNKSEETKKS CCCCCCCCCHHHHHH	44.52	22106047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTCU2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTCU2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTCU2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SODC_YEAST	SOD1	genetic	8530401
CRS5_YEAST	CRS5	genetic	8530401
CRS5_YEAST	CRS5	genetic	7929222
NAM8_YEAST	NAM8	genetic	18268012
SNU56_YEAST	SNU56	genetic	18268012

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTCU2_YEAST

Related Literatures of Post-Translational Modification