UniProt ID | MOB3C_HUMAN | |
---|---|---|
UniProt AC | Q70IA8 | |
Protein Name | MOB kinase activator 3C | |
Gene Name | MOB3C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 216 | |
Subcellular Localization | ||
Protein Description | May regulate the activity of kinases.. | |
Protein Sequence | MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Acetylation | CLKQVFAKDKTFRPR HHHHHHHCCCCCCCC | 48.57 | 19657559 | |
14 | Phosphorylation | QVFAKDKTFRPRKRF HHHHCCCCCCCCCCC | 34.70 | - | |
25 | Phosphorylation | RKRFEPGTQRFELYK CCCCCCCCHHHHHHH | 27.56 | 28060719 | |
37 | Phosphorylation | LYKKAQASLKSGLDL HHHHHHHHHHCCCCH | 25.01 | 28060719 | |
75 | Phosphorylation | FNRINLIYGTMAERC HHHHHHHHHHHHHHH | 15.09 | 27642862 | |
89 | Phosphorylation | CSETSCPVMAGGPRY HCCCCCCCCCCCCCC | 4.88 | 24719451 | |
113 | Phosphorylation | YRRPAKLSAPRYMAL HCCCCCCCHHHHHHH | 35.20 | 24719451 | |
165 | Phosphorylation | LFRVFVHVYIHHFDS HHHHHHHHHHHHHHH | 3.95 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB3C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB3C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB3C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LATS1_HUMAN | LATS1 | physical | 19739119 | |
LATS2_HUMAN | LATS2 | physical | 19739119 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...