MMP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MMP1_HUMAN
• UniProt AC: P03956
• Protein Name: Interstitial collagenase
• Gene Name: MMP1
• Organism: Homo sapiens (Human).
• Sequence Length: 469
• Subcellular Localization: Secreted, extracellular space, extracellular matrix .
• Protein Description: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. [PubMed: 2557822]
• Protein Sequence: MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MHSFPPLLLL -----CCCCHHHHHH	37.84	24043423
17	Phosphorylation	LLFWGVVSHSFPATL HHHHHHHCCCCCCCC	15.82	24043423
19	Phosphorylation	FWGVVSHSFPATLET HHHHHCCCCCCCCCC	25.97	24043423
23	Phosphorylation	VSHSFPATLETQEQD HCCCCCCCCCCHHHH	25.93	24043423
26	Phosphorylation	SFPATLETQEQDVDL CCCCCCCCHHHHHHH	40.28	24043423
57	Phosphorylation	QVEKRRNSGPVVEKL CHHHHHCCCHHHHHH	42.54	25171405
120	N-linked_Glycosylation	HLTYRIENYTPDLPR EEEEEEEECCCCCCC	43.54	10092871
121	Phosphorylation	LTYRIENYTPDLPRA EEEEEEECCCCCCCH	13.58	24275569
122	Phosphorylation	TYRIENYTPDLPRAD EEEEEECCCCCCCHH	23.16	24275569
142	Phosphorylation	EKAFQLWSNVTPLTF HHHHHHHCCCCCCEE	29.98	24275569
153	Phosphorylation	PLTFTKVSEGQADIM CCEEEECCCCCCCEE	37.25	-
172	Phosphorylation	RGDHRDNSPFDGPGG CCCCCCCCCCCCCCC	31.09	26091039
274	Phosphorylation	VQPIGPQTPKACDSK CCCCCCCCCCCCCCC	29.86	25171405
276	Acetylation	PIGPQTPKACDSKLT CCCCCCCCCCCCCCC	66.10	19413330
280	Phosphorylation	QTPKACDSKLTFDAI CCCCCCCCCCCCEEH	29.46	19413330
288	Phosphorylation	KLTFDAITTIRGEVM CCCCEEHHHCCCEEE	20.21	19413330
289	Phosphorylation	LTFDAITTIRGEVMF CCCEEHHHCCCEEEE	11.54	19413330
360	Phosphorylation	GQNVLHGYPKDIYSS CCCCCCCCCHHHHHH	9.07	10092871
382	Phosphorylation	KHIDAALSEENTGKT CHHHHHHCCCCCCCE	37.83	24961811
450	Ubiquitination	RQYKFDPKTKRILTL CEEECCHHCCEEEEE	69.40	21890473
462	Phosphorylation	LTLQKANSWFNCRKN EEEHHHHHHCCCCCC	37.59	24961811

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
360	Y	Phosphorylation	Kinase	PKDCC	Q504Y2	Uniprot
-	K	Ubiquitination	E3 ubiquitin ligase	COP1	Q8NHY2	PMID:12615916

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MMP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MMP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PGCB_HUMAN	BCAN	physical	10986281
ITA2_HUMAN	ITGA2	physical	11359786
SOX8_HUMAN	SOX8	physical	21988832
PAR1_HUMAN	F2R	physical	25241761

Drug and Disease Associations

• Kegg Disease
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.